RVVCREASHAGSWYTASGPQLNAQLEGWLSQVQSTKRPARAIIAPHAGYTYCGSCAAHAYKQVDPSITRRIFILGPSHHV
PLSRCALSSVDIYRTPLYDLRIDQKIYGELWKTGMFERMSLQTDEDEHSIEMHLPYTAKAMESHKDEFTIIPVLVGALSE
SKEQEFGKLFSKYLADPSNLFVVSSDFCHWGQRFRYSYYDESQGEIYRSIEHLDKMGMSIIEQLDPVSFSNYLKKYHNTI
CGRHPIGVLLNAITELQKNGMNMSFSFLNYAQSSQCRNWQDSSVSYAAGALTVH
The query sequence (length=294) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.
# | Hit | Hit length |
Aligned length |
Identity (normalized by query) |
Identity (normalized by hit) |
Identity (normalized by aligned length) |
E-value | Homologs to hit |
---|---|---|---|---|---|---|---|---|
1 | 7kq8:A | 294 | 294 | 1.0000 | 1.0000 | 1.0000 | 0.0 | 7kq8:B, 7kq8:C, 7kq8:D, 7l5c:A, 7l5c:B, 7l5c:C, 7m8h:A, 7m8h:B, 7m8h:C, 7m8h:D |
2 | 6pif:H | 198 | 70 | 0.0748 | 0.1111 | 0.3143 | 1.6 | 8fuk:H, 6lnb:A, 6lnc:A, 6pig:H, 6pij:H, 6uvn:A |
3 | 5gug:A | 1721 | 61 | 0.0578 | 0.0099 | 0.2787 | 5.9 | 5gug:B, 1n4k:A, 3t8s:B, 3uj0:A, 3uj0:B, 5xa1:A, 5xa1:B |
4 | 7cte:D | 406 | 77 | 0.0680 | 0.0493 | 0.2597 | 6.6 | 7ctf:D, 7ctg:D, 7jpo:D, 7jpp:D, 7jpq:D, 7jpr:D, 7jps:D, 5uj7:C, 5uj7:D, 5ujm:D |
5 | 5oeu:A | 460 | 88 | 0.0680 | 0.0435 | 0.2273 | 9.7 |