RVLDVEVYSSRSKVYVAVDGTTVLEDEAREQGRGIHVIVLNQATGHVMAKRVFDTYSPHEDEAMVLFLNMVAPGRVLICT
VKDEGSFHLKDTAKALLRSLGSQAGPALGWRDTWAFVGRKGGPVFGEKHSKSPALSSWGDPVLLKTDVPLSSA
The query sequence (length=153) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.
# | Hit | Hit length |
Aligned length |
Identity (normalized by query) |
Identity (normalized by hit) |
Identity (normalized by aligned length) |
E-value | Homologs to hit |
---|---|---|---|---|---|---|---|---|
1 | 5ggi:B | 551 | 153 | 1.0000 | 0.2777 | 1.0000 | 9.72e-106 | 5ggi:A, 5ggj:A, 5ggj:B, 5ggk:A, 5ggk:B, 5ggl:A, 5ggl:B, 5ggn:A, 5ggn:B, 5ggo:A, 5ggo:B, 5ggp:A, 5ggp:B, 5xfc:A, 5xfc:B |
2 | 6rxu:CW | 382 | 54 | 0.1307 | 0.0524 | 0.3704 | 1.5 | 6rxv:CW, 6rxx:CW, 6rxz:CW |
3 | 5mgu:A | 407 | 36 | 0.0850 | 0.0319 | 0.3611 | 2.2 | 3cmq:A, 3hfv:A, 5mgh:A, 5mgw:A, 8p8x:A, 3teg:A, 3tup:A |
4 | 8cp6:B | 1084 | 46 | 0.1046 | 0.0148 | 0.3478 | 5.3 | |
5 | 2ycl:B | 309 | 98 | 0.1438 | 0.0712 | 0.2245 | 6.1 | 2h9a:B |
6 | 8a3w:SP | 142 | 50 | 0.0915 | 0.0986 | 0.2800 | 7.0 | 8a98:SP, 7ase:m, 6az1:P, 5opt:M, 8ova:AS, 8ove:AS, 8ovj:SP, 8rxh:SP, 8rxx:SP, 5t2a:AS, 4v8m:AS |