RTTRDDLINGNSASCADVIFIYARGSTETGNLGTLGPSIASNLESAFGKDGVWIQGVGGAYRATLGDNALPRGTSSAAIR
EMLGLFQQANTKCPDATLIAGGYSQGAALAAASIEDLDSAIRDKIAGTVLFGYTKNLQNRGRIPNYPADRTKVFCNTGDL
VCTGSLIVAAPHLAYGPDARGPAPEFLIEKVRAVRG
The query sequence (length=196) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.
# | Hit | Hit length |
Aligned length |
Identity (normalized by query) |
Identity (normalized by hit) |
Identity (normalized by aligned length) |
E-value | Homologs to hit |
---|---|---|---|---|---|---|---|---|
1 | 3esb:A | 199 | 196 | 0.9949 | 0.9799 | 0.9949 | 1.40e-142 | 3ef3:A, 3esa:A, 3esa:B, 3esc:A, 3esd:A, 1oxm:A, 1oxm:B, 1xzc:A, 1xzk:A, 1xzk:B, 1xzl:A, 1xzm:A |
2 | 3dea:B | 189 | 191 | 0.5000 | 0.5185 | 0.5131 | 3.84e-64 | 3dea:A |
3 | 4pse:A | 220 | 169 | 0.3010 | 0.2682 | 0.3491 | 9.20e-23 | 4pse:B |
4 | 4la6:A | 325 | 90 | 0.1429 | 0.0862 | 0.3111 | 0.94 | 3v1v:A, 3v1x:A |
5 | 2q2t:A | 293 | 76 | 0.1173 | 0.0785 | 0.3026 | 1.1 | 2q2u:A, 2q2u:B, 2q2u:C, 2q2u:D |
6 | 7y7q:A | 951 | 46 | 0.0765 | 0.0158 | 0.3261 | 1.4 | 2j7n:A, 2j7n:B, 2j7o:A, 7y7p:A, 7y7p:B, 7y7r:A, 7y7r:B, 7y7s:A, 7y7s:B, 7y7t:A, 7y7t:B |
7 | 7y7q:B | 906 | 51 | 0.0867 | 0.0188 | 0.3333 | 1.7 | |
8 | 8am6:AAA | 547 | 68 | 0.1122 | 0.0402 | 0.3235 | 2.7 | 8am3:AAA, 8am3:BBB, 8am6:BaB, 8am8:BBB, 8am8:AAA |
9 | 6oxd:A | 736 | 83 | 0.1020 | 0.0272 | 0.2410 | 4.6 | 6oxc:A |
10 | 6ku3:B | 318 | 53 | 0.0867 | 0.0535 | 0.3208 | 4.6 | 6ku3:A, 6ku3:D, 6ku3:C |
11 | 5z25:A | 96 | 35 | 0.0612 | 0.1250 | 0.3429 | 9.0 | |
12 | 6hgg:A | 339 | 43 | 0.0765 | 0.0442 | 0.3488 | 9.7 | 6ftp:A, 6hgf:A, 6hgi:A, 6hgk:A, 6hgl:A, 6hgm:A, 5om2:A, 5om3:A, 5om7:A |