RTRPRVGHIQFLNCLPLYWGLARTGTLLDFELTKDTPEKLSEQLVRGDLDIGPVTLVEFLKNADDLVAFPDIAVGCDGPV
MSCVIVSQVPLDRLDGARVALGSTSRTSVRLAQLLLSERFGVQPDYYTCPPDLSLMMQEADAAVLIGDAALRANMIDGPR
YGLDVHDLGALWKEWTGLPFVFAVWAARRDYAEREPVITRKVHEAFLASRNLSLEEVEKVAEQAARWEAFDEDTLAKFFT
TLDFRFGAPQLEAVTEFARRVGPTTGFPADVKVELLKPLE
The query sequence (length=280) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.
# | Hit | Hit length |
Aligned length |
Identity (normalized by query) |
Identity (normalized by hit) |
Identity (normalized by aligned length) |
E-value | Homologs to hit |
---|---|---|---|---|---|---|---|---|
1 | 7ahr:B | 287 | 280 | 0.9964 | 0.9721 | 0.9964 | 0.0 | 7ahr:A, 7an5:A, 7an5:B, 7an6:A, 7an6:B, 7an7:A, 7an7:B, 7an8:A, 7an8:B, 7an9:A, 7an9:B, 7ywc:A, 7ywc:B |
2 | 6o9a:A | 271 | 269 | 0.2857 | 0.2952 | 0.2974 | 1.49e-22 | 6o9a:B |
3 | 3a3u:A | 270 | 209 | 0.2107 | 0.2185 | 0.2823 | 1.79e-07 | 2czl:A |
4 | 6g4d:B | 453 | 130 | 0.1286 | 0.0795 | 0.2769 | 2.1 | 7b4i:AAA, 7b4i:BBB, 7b4j:A, 7b4j:B, 6g4d:A, 6g4e:A, 6g4e:B, 6g4f:A, 6g4f:B, 6tb0:A, 6tb0:B, 6tb1:A, 6tb1:B |
5 | 7w6u:A | 597 | 43 | 0.0643 | 0.0302 | 0.4186 | 3.1 | 7w6r:A, 7xby:A |
6 | 3oi8:A | 156 | 34 | 0.0536 | 0.0962 | 0.4412 | 3.2 | 3oi8:B |
7 | 5kr3:A | 458 | 113 | 0.1000 | 0.0611 | 0.2478 | 4.2 | 5kr3:B, 5kr4:A, 5kr4:B, 5kr5:A, 5kr5:B |
8 | 8the:A | 712 | 73 | 0.0750 | 0.0295 | 0.2877 | 4.2 | |
9 | 6ssy:A | 298 | 143 | 0.1214 | 0.1141 | 0.2378 | 4.5 | 6ssy:B, 6st0:A, 6st0:B |
10 | 4xqk:A | 1517 | 92 | 0.0821 | 0.0152 | 0.2500 | 6.2 | 4xqk:B |
11 | 8umv:D | 329 | 46 | 0.0607 | 0.0517 | 0.3696 | 7.2 | 8ui7:D, 8ui8:D, 8ui9:D, 8uii:D, 8umt:D, 8umw:D, 8umy:D, 8un0:D, 8unj:D, 6vvo:D, 7z6h:D |
12 | 1jlk:A | 141 | 51 | 0.0679 | 0.1348 | 0.3725 | 7.8 | |
13 | 1obf:O | 335 | 39 | 0.0500 | 0.0418 | 0.3590 | 7.9 | 1obf:P |
14 | 4fln:B | 464 | 23 | 0.0393 | 0.0237 | 0.4783 | 9.0 | 4fln:A, 4fln:C |
15 | 3lez:A | 260 | 50 | 0.0571 | 0.0615 | 0.3200 | 9.1 | |
16 | 1g4u:S | 360 | 47 | 0.0607 | 0.0472 | 0.3617 | 9.1 |