RTKRWEGGYERTWEILKEVRLGMMRHLYVVVDGSRTMEDQDLKPNRLTCTLKLLEYFVEEYFDQNPISQIGIIVTKSKRA
EKLTELSGNPRKHITSLKKAVDMTCHGEPSLYNSLSIAMQTLKHMPGHTSREVLIIFSSLTTCDPSNIYDLIKTLKAAKI
RVSVIGLSAEVRVCTVLARETGGTYHVILDESHYKELLTHHVSPPPASSSSECSLIRMGFPQHTIASLSDQDAKPSFSMA
EPGLTLGGYFCPQCRAKYCELPVECKICGLTLVSAPHLARSYHHLFPLDAFQEIPLEEYNGERFCYGCQGELKDQHVYVC
AVCQNVFCVDCDVFVHDSLHCCPGCIH
The query sequence (length=347) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.
# | Hit | Hit length |
Aligned length |
Identity (normalized by query) |
Identity (normalized by hit) |
Identity (normalized by aligned length) |
E-value | Homologs to hit |
---|---|---|---|---|---|---|---|---|
1 | 7ena:2 | 385 | 378 | 0.9914 | 0.8935 | 0.9101 | 0.0 | 8bvw:4, 8byq:4, 8ebs:E, 8ebt:E, 8ebu:E, 8ebv:E, 8ebw:E, 8ebx:E, 8eby:E, 7egb:2, 7egc:2, 7enc:2, 8gxq:HG, 8gxs:HG, 7lbm:a, 7nvr:6, 7nvw:6, 7nvx:6, 7nvy:6, 7nvz:6, 7nw0:6, 6o9l:6, 6o9m:6, 8wak:2, 8wal:2, 8wan:2, 8wao:2, 8wap:2, 8waq:2, 8war:2, 8was:2, 1z60:A |
2 | 6nmi:E | 366 | 330 | 0.8963 | 0.8497 | 0.9424 | 0.0 | |
3 | 7ad8:D | 280 | 327 | 0.7983 | 0.9893 | 0.8471 | 0.0 | 6ro4:D |
4 | 8cen:6 | 383 | 380 | 0.4323 | 0.3916 | 0.3947 | 2.22e-91 | 8ceo:6, 7k01:6, 7k04:6, 7m2u:6, 7ml0:6, 7ml1:6, 7ml2:6, 7ml3:6, 7ml4:6, 7o4i:6, 7o4j:6, 7o4k:6, 7o4l:6, 7o72:6, 7o73:6, 7o75:6, 7zs9:6, 7zsa:6, 7zsb:6 |
5 | 6gym:6 | 335 | 337 | 0.3660 | 0.3791 | 0.3769 | 8.52e-70 | 5oqj:6, 5oqm:6 |
6 | 5o85:D | 53 | 62 | 0.1499 | 0.9811 | 0.8387 | 4.79e-27 | 5o85:B |
7 | 5nus:B | 74 | 68 | 0.0692 | 0.3243 | 0.3529 | 6.86e-08 | 5obz:B |
8 | 5d4y:A | 314 | 103 | 0.0749 | 0.0828 | 0.2524 | 0.33 | 5d4y:B |
9 | 6n8m:Y | 128 | 100 | 0.0807 | 0.2188 | 0.2800 | 0.53 | 6n8n:Y, 6n8o:Y, 6rzz:s, 6s05:s |
10 | 1uqw:A | 487 | 64 | 0.0576 | 0.0411 | 0.3125 | 1.3 | 1uqw:B |
11 | 6r4n:C | 147 | 55 | 0.0576 | 0.1361 | 0.3636 | 2.7 | 6r4n:A, 6r4n:E |
12 | 4uir:A | 641 | 81 | 0.0634 | 0.0343 | 0.2716 | 5.4 | |
13 | 6zot:B | 180 | 41 | 0.0346 | 0.0667 | 0.2927 | 8.8 | 6zot:A |