RTDCYGNVNRIDTTGASCKTAKPEGLSYCGVPASKTIAERDLKAMDRYKTIIKKVGEKLCVEPAVIAGIISRESHAGKVL
KNGWGDRGNGFGLMQVDKRSHKPQGTWNGEVHITQGTTILTDFIKRIQKKFPSWTKDQQLKGGISAYNAGAGNVRSYARM
DIGTTHDDYANDVVARAQYYKQHGY
The query sequence (length=185) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.
| # | Hit | Hit length |
Aligned length |
Identity (normalized by query) |
Identity (normalized by hit) |
Identity (normalized by aligned length) |
E-value | Homologs to hit |
|---|---|---|---|---|---|---|---|---|
| 1 | 1lsp:A | 185 | 185 | 1.0000 | 1.0000 | 1.0000 | 3.36e-139 | |
| 2 | 5o1j:A | 580 | 159 | 0.2108 | 0.0672 | 0.2453 | 0.62 | 5mpq:A |
umich.edu