BioLiP

>protein
RSNAEIVCEAIKTIGIGATAAQLTRQLNMEKKEINRVLYSLAKKGKVYSSDDIPPRWFMTT

The query sequence (length=61) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.

#	Hit	Hit length	Aligned length	Identity (normalized by query)	Identity (normalized by hit)	Identity (normalized by aligned length)	E-value	Homologs to hit
1	7c0i:B	67	61	0.9836	0.8955	0.9836	1.09e-38	7c0i:A, 7c0i:C
2	3f21:A	67	43	0.3934	0.3582	0.5581	1.27e-09	2acj:B, 2acj:C, 2acj:D, 3f21:B, 3f21:C, 3f22:A, 3f22:B, 3f22:C, 3f23:A, 3f23:B, 3f23:C, 2gxb:A, 2gxb:B, 3irq:B, 3irq:A, 3irq:D, 3irq:C, 3irr:C, 3irr:D, 3irr:A, 3irr:B, 1qbj:A, 1qbj:B, 1qbj:C, 5zu1:C, 5zu1:A, 5zu1:B, 5zuo:B, 5zuo:C, 5zuo:D, 5zup:B, 5zup:C, 5zup:D
3	2acj:A	53	39	0.3770	0.4340	0.5897	1.86e-09	5zuo:A, 5zup:A
4	5zu1:D	47	32	0.3279	0.4255	0.6250	9.14e-08
5	1sfu:A	70	41	0.2787	0.2429	0.4146	1.08e-04	1sfu:B
6	4kmf:A	62	40	0.1967	0.1935	0.3000	1.12e-04
7	4lb5:B	63	53	0.2623	0.2540	0.3019	0.003	4lb5:A, 4lb6:B
8	7c0j:B	62	60	0.3443	0.3387	0.3500	0.004	7c0j:A
9	4wcg:B	61	43	0.2131	0.2131	0.3023	0.005	4wcg:A
10	3ei9:A	412	58	0.2951	0.0437	0.3103	0.77	3ei5:A, 3ei5:B, 3ei6:A, 3ei6:B, 3ei8:A, 3ei8:B, 3ei9:B, 3eia:A, 3eia:B, 3eib:A, 3eib:B, 2z1z:A, 2z1z:B, 2z20:A, 2z20:B
11	3tgn:B	146	34	0.1803	0.0753	0.3235	1.5	3tgn:A
12	7nh7:A	295	28	0.1803	0.0373	0.3929	1.6
13	8a8o:A	556	25	0.1967	0.0216	0.4800	1.8	8a8o:B
14	6pas:B	576	20	0.1475	0.0156	0.4500	3.7	6pat:B
15	6yxx:BF	346	48	0.2131	0.0376	0.2708	5.2	7aoi:BF, 6hiv:BF, 6hix:BF, 6yxy:BF

[Back]