BioLiP

>protein
RSGHTNNWAVLVCTSRFWFNYRHVANTLSVYRSVKRLGIPDSHIVLMLADDMACNPRNPKPATVFSHKNMELNVYGDDVE
VDYRSYEVTVENFLRVLTGRIPPSTPRSKRLLSDDRSNILIYMTGHGGNGFLKFQDSEEITNIELADAFEQMWQKRRYNE
LLFIIDTCQGASMYERFYSPNIMALASSQVGEDSLSHQPDPAIGVHLMDRYTFYVLEFLEEINPASQTNMNDLFQVCPKS
LCVSTPGHRTDLFQRDPKNVLITDFFGSVRKVEITTETIKLQQMEPLKYAEQLPVAQIIHQKPKLKDWHPPGGFILGLWA
LIIMVFFKTYG

The query sequence (length=331) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.

#	Hit	Hit length	Aligned length	Identity (normalized by query)	Identity (normalized by hit)	Identity (normalized by aligned length)	E-value	Homologs to hit
1	7wld:K	331	331	1.0000	1.0000	1.0000	0.0	8imx:K, 8imy:K, 7w72:K
2	7fqi:A	265	214	0.2085	0.2604	0.3224	2.78e-27	4aw9:A, 4awa:A, 4awb:A, 4awb:B, 7fqh:A, 7fqh:B, 7fqh:D, 7fqi:C, 7fqi:B, 7fqj:A, 7fqj:C, 7fqj:B, 7fqk:A, 7fqk:B, 7fqk:C, 7fqk:D, 7fql:A, 7fql:F, 7fql:B, 7fql:H, 7fql:C, 7fql:G, 7fql:D, 7fql:E, 5lu8:A, 5lu9:A, 5lua:B, 5lub:B, 7o50:A, 7o50:B
3	6azt:A	274	190	0.1752	0.2117	0.3053	3.75e-22
4	5obt:B	230	190	0.1722	0.2478	0.3000	3.74e-21	5obt:A
5	6idv:A	425	246	0.1964	0.1529	0.2642	6.46e-21	6idv:B
6	3vc6:A	420	68	0.0665	0.0524	0.3235	0.75
7	5bsz:A	247	106	0.0695	0.0931	0.2170	1.9
8	8fok:1	1046	136	0.1088	0.0344	0.2647	5.3	3flo:B, 3flo:D, 3flo:F, 3flo:H, 4fxd:A, 4fxd:B, 4fyd:A, 4fyd:B
9	2j5s:A	250	162	0.1088	0.1440	0.2222	8.0	2j5s:B

[Back]