RRYSVGYALAPKKQASFIQVSLVNLAKERGIDLIKIDTDKPLIDQGPFDCVLHKMDGDDWKRQLKEYGSEFPQALIIDSP
EAIERLHNRISMLQAVGEVEIDCENASFGIPKQTVIYDAKMVSAINLENEGLEFPVIAKPLVADGSAKSHKMLLVFNKDG
LRKLKPPIVLQEFVNHGAVIFKVYVVGDYVKCVKRKSLPDVKERLESYLPFSQVSNDDKYYKLMNLENAEYPPLSFLTNI
ARGLRRVTKLHLFNFDVIRDDRVGNRYLIIDINYFPGYAKMPNYERVLTDFFWDVLNQNDKS
The query sequence (length=302) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.
# | Hit | Hit length |
Aligned length |
Identity (normalized by query) |
Identity (normalized by hit) |
Identity (normalized by aligned length) |
E-value | Homologs to hit |
---|---|---|---|---|---|---|---|---|
1 | 8oxe:A | 302 | 302 | 1.0000 | 1.0000 | 1.0000 | 0.0 | |
2 | 7tn8:A | 281 | 297 | 0.5530 | 0.5943 | 0.5623 | 3.68e-117 | |
3 | 2qb5:A | 338 | 314 | 0.3179 | 0.2840 | 0.3057 | 7.76e-41 | 2q7d:A, 2q7d:B, 2qb5:B |
4 | 7pup:A | 479 | 182 | 0.1954 | 0.1232 | 0.3242 | 1.21e-19 | |
5 | 1z2n:X | 311 | 242 | 0.1954 | 0.1897 | 0.2438 | 9.10e-14 | 1z2o:X, 1z2p:X |
6 | 7zn6:A | 576 | 51 | 0.0695 | 0.0365 | 0.4118 | 2.2 | |
7 | 6w2j:B | 1364 | 70 | 0.0762 | 0.0169 | 0.3286 | 2.5 | |
8 | 5v13:A | 268 | 129 | 0.1126 | 0.1269 | 0.2636 | 2.8 | 5v13:B, 5v13:C |
9 | 2d30:A | 124 | 38 | 0.0397 | 0.0968 | 0.3158 | 3.4 | 2d30:B |
10 | 2p88:A | 369 | 104 | 0.0728 | 0.0596 | 0.2115 | 5.7 | 2p88:B, 2p88:C, 2p88:D, 2p88:E, 2p88:F, 2p88:G, 2p88:H, 2p8b:A, 2p8c:A |
11 | 8fgw:B | 1152 | 53 | 0.0464 | 0.0122 | 0.2642 | 7.8 | 8fh3:B |