RRYRPTNLEPGDAGIYHHEGHRIRLTKDGRCIITCKTVEVYADESMTVDTPRTTFTGDVEIQKGLGVKGKSQFDSNITAP
DAIINGKSTDKHIHRGDSGGTTGPMQLEH
The query sequence (length=109) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.
# | Hit | Hit length |
Aligned length |
Identity (normalized by query) |
Identity (normalized by hit) |
Identity (normalized by aligned length) |
E-value | Homologs to hit |
---|---|---|---|---|---|---|---|---|
1 | 3vto:B | 110 | 109 | 1.0000 | 0.9909 | 1.0000 | 2.58e-78 | 3vto:A, 3vto:C, 3vto:P, 3vto:Q, 3vto:R |
2 | 3aqj:A | 117 | 84 | 0.2844 | 0.2650 | 0.3690 | 4.05e-06 | 3aqj:B, 3aqj:C, 3aqj:P, 3aqj:Q, 3aqj:R, 3qr7:A, 3qr7:B |
3 | 4ru3:A | 205 | 36 | 0.1284 | 0.0683 | 0.3889 | 0.41 | |
4 | 8f70:A | 567 | 76 | 0.2018 | 0.0388 | 0.2895 | 2.8 | 8f5n:A, 6n0a:A, 6n0a:B |
5 | 8f70:A | 567 | 76 | 0.2018 | 0.0388 | 0.2895 | 2.8 | 8f5n:A, 6n0a:A, 6n0a:B |
6 | 1o12:A | 363 | 55 | 0.1560 | 0.0468 | 0.3091 | 5.5 | 1o12:B |
7 | 5yeu:A | 381 | 26 | 0.1009 | 0.0289 | 0.4231 | 6.4 | 5yeu:B |
8 | 6t5e:A | 439 | 44 | 0.1376 | 0.0342 | 0.3409 | 6.6 | |
9 | 1rm6:A | 761 | 28 | 0.0917 | 0.0131 | 0.3571 | 7.6 | 1rm6:D, 1sb3:A, 1sb3:D |