RRTPPLGPMPNSDIDLSNLERLEKYRSFDRYRRRA
The query sequence (length=35) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.
| # | Hit | Hit length |
Aligned length |
Identity (normalized by query) |
Identity (normalized by hit) |
Identity (normalized by aligned length) |
E-value | Homologs to hit |
|---|---|---|---|---|---|---|---|---|
| 1 | 7qh7:6 | 292 | 35 | 1.0000 | 0.1199 | 1.0000 | 6.73e-18 | |
| 2 | 7o9k:6 | 331 | 35 | 1.0000 | 0.1057 | 1.0000 | 7.72e-18 | 7a5f:63, 7a5g:63, 7a5h:6, 7a5i:63, 7a5j:6, 7a5k:63, 3j7y:6, 3j9m:6, 6nu2:6, 6nu3:6, 7o9m:6, 7of0:6, 7of2:6, 7of3:6, 7of4:6, 7of5:6, 7of6:6, 7of7:6, 7oi6:6, 7oi7:6, 7oi8:6, 7oi9:6, 7oia:6, 7oib:6, 7oic:6, 7oid:6, 7oie:6, 5ool:6, 5oom:6, 7pd3:6, 7qh6:6, 8qu5:6 |
| 3 | 8any:6 | 354 | 35 | 1.0000 | 0.0989 | 1.0000 | 9.42e-18 | 6i9r:6, 8k2a:Ll, 8k2b:Ll, 7l08:6, 7l20:6, 7odr:6, 7ods:6, 7odt:6, 7og4:6, 8oir:Bn, 8oit:Bn, 8pk0:6, 7po4:6, 7qi4:6, 7qi5:6, 7qi6:6, 8qsj:6, 8qu1:6, 6vlz:6, 6vmi:6, 8xt0:Ll, 8xt1:Ll, 8xt2:Ll, 8xt3:Ll, 6zm5:6, 6zm6:6, 6zs9:6, 6zsa:6, 6zsb:6, 6zsc:6, 6zsd:6, 6zse:6, 6zsg:6 |
| 4 | 5aj4:Bb | 354 | 35 | 0.8286 | 0.0819 | 0.8286 | 6.28e-14 | 6gaw:Bb, 6gb2:Bb, 7nqh:Bb, 7nql:Bb, 7nsh:Bb, 7nsi:Bb, 7nsj:Bb, 8oin:Bn, 8oiq:Bn, 6ydp:Bb, 6ydw:Bb |
| 5 | 8wnf:A | 918 | 20 | 0.2571 | 0.0098 | 0.4500 | 2.3 | 8wng:A, 8wni:A, 8wnj:A, 8wo2:A, 8wo3:A |
| 6 | 5f1a:A | 553 | 35 | 0.4000 | 0.0253 | 0.4000 | 2.8 | 5f19:A, 5f19:B, 5f1a:B, 5ikq:A, 5ikq:B, 5ikr:A, 5ikr:B, 5ikt:A, 5ikt:B, 5ikv:A, 5ikv:B, 5kir:A, 5kir:B |
| 7 | 6ii7:A | 355 | 18 | 0.2286 | 0.0225 | 0.4444 | 3.2 | |
| 8 | 1o5k:A | 295 | 24 | 0.2571 | 0.0305 | 0.3750 | 6.9 | |
| 9 | 5a3k:A | 335 | 23 | 0.3143 | 0.0328 | 0.4783 | 9.9 | 5a3k:B, 5a3k:C, 5ag3:A, 5ag3:B |
umich.edu