RRSRRCGQCPGCQVPEDCGVCTNCLDKPKFGGRNIKKQCCKMRKCQNLQWM
The query sequence (length=51) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.
# | Hit | Hit length |
Aligned length |
Identity (normalized by query) |
Identity (normalized by hit) |
Identity (normalized by aligned length) |
E-value | Homologs to hit |
---|---|---|---|---|---|---|---|---|
1 | 2j2s:A | 72 | 51 | 1.0000 | 0.7083 | 1.0000 | 2.23e-32 | 2jyi:A, 2kkf:A, 4nw3:A |
2 | 4pzi:A | 61 | 48 | 0.5882 | 0.4918 | 0.6250 | 6.61e-15 | |
3 | 5w9q:A | 56 | 45 | 0.4706 | 0.4286 | 0.5333 | 6.33e-09 | 5w9q:B |
4 | 3qmb:A | 54 | 46 | 0.4510 | 0.4259 | 0.5000 | 9.09e-09 | 3qmc:A, 3qmd:A, 3qmg:A, 3qmh:A, 3qmi:A |
5 | 4wxx:B | 1178 | 48 | 0.4706 | 0.0204 | 0.5000 | 1.04e-06 | 3epz:A, 3epz:B, 7lmk:A, 7lmk:B, 7lmk:C, 7lmk:D, 7lmm:A, 7lmm:B, 7lmm:C, 7lmm:D, 3pta:A, 7sfc:A, 7sfd:A, 7sfe:A, 7sff:A, 7sfg:A, 5wvo:C, 4wxx:A, 6x9i:A, 6x9j:A, 6x9k:A, 7xi9:A, 7xib:A, 5ydr:B, 4yoc:A |
6 | 3swr:A | 965 | 45 | 0.4706 | 0.0249 | 0.5333 | 1.69e-06 | |
7 | 3pt6:B | 915 | 45 | 0.4902 | 0.0273 | 0.5556 | 2.31e-06 | 4da4:A, 3pt6:A, 6w8v:A |
8 | 4hp1:C | 51 | 49 | 0.3922 | 0.3922 | 0.4082 | 1.07e-04 | 4hp3:C |
9 | 4bbq:A | 111 | 44 | 0.4118 | 0.1892 | 0.4773 | 0.001 | 4bbq:B |
10 | 5exh:C | 45 | 49 | 0.3529 | 0.4000 | 0.3673 | 0.002 | 4z3c:C |
11 | 4o64:A | 116 | 45 | 0.4118 | 0.1810 | 0.4667 | 0.002 | 4o64:B, 4o64:C |
12 | 5vc9:C | 46 | 49 | 0.3529 | 0.3913 | 0.3673 | 0.008 | 5vc9:F |
13 | 6asd:C | 45 | 48 | 0.3725 | 0.4222 | 0.3958 | 0.018 | |
14 | 6asb:I | 121 | 29 | 0.2745 | 0.1157 | 0.4828 | 0.26 | 6asb:C, 6asb:L |
15 | 6asb:F | 85 | 30 | 0.2745 | 0.1647 | 0.4667 | 0.34 | |
16 | 5w9s:C | 44 | 49 | 0.3137 | 0.3636 | 0.3265 | 0.61 | |
17 | 7evo:D | 200 | 25 | 0.2157 | 0.0550 | 0.4400 | 1.2 | 8hk1:D, 6n3e:A, 6n3f:C, 6nsx:A |
18 | 1oyw:A | 516 | 14 | 0.1765 | 0.0174 | 0.6429 | 4.5 | 1oyy:A |
19 | 4ylf:A | 276 | 29 | 0.1765 | 0.0326 | 0.3103 | 5.0 | 4ylf:C, 4yry:A, 4yry:C |
20 | 5d08:A | 384 | 17 | 0.1569 | 0.0208 | 0.4706 | 6.7 | 5d08:B, 5d0a:A, 5d0a:B, 5d0a:C, 5d0a:D, 5d0b:A, 5d0b:B, 5t8y:B, 5t8y:A |
21 | 4q47:A | 513 | 19 | 0.1569 | 0.0156 | 0.4211 | 6.9 | 4q47:B, 4q48:A, 4q48:B |
22 | 7tj9:A | 1111 | 13 | 0.1373 | 0.0063 | 0.5385 | 8.3 | |
23 | 2cd9:A | 363 | 14 | 0.1569 | 0.0220 | 0.5714 | 8.4 | 2cd9:B, 2cda:A, 2cda:B, 2cdb:A, 2cdb:B, 2cdb:C, 2cdb:D, 2cdc:A, 2cdc:B, 2cdc:C, 2cdc:D |
24 | 8r9b:A | 301 | 13 | 0.1569 | 0.0266 | 0.6154 | 9.0 | 7b5o:J, 7b5q:J, 8orm:J, 8p4z:A, 8p4z:B, 8p6v:J, 8p6w:J, 8p6x:J, 8p6y:J, 8p6z:J, 8p70:J, 8p71:J, 8p72:J, 8p73:J, 8p74:J, 8p75:J, 8p76:J, 8p77:J, 8p78:J, 8p7l:J, 8plz:J, 8r99:A, 8r9a:A, 8r9b:B, 8r9b:C, 8r9b:D, 8r9o:A, 8r9o:B, 8r9s:A, 8r9s:B, 8r9u:A, 8r9u:B, 1ua2:A, 1ua2:B, 1ua2:C, 1ua2:D, 6xbz:J, 6xd3:J |
25 | 8sor:A | 1156 | 17 | 0.1569 | 0.0069 | 0.4706 | 9.8 |