RRRVLTKDGRSNVRMEHIADKRFLYLKDLWTTFIDMQWRYKLLLFSATFAGTWFLFGVVWYLVAVAHGDLLELGPPANHT
The query sequence (length=310) is searched through a non-redundant set of database sequences
clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.
# |
Hit |
Hit length |
Aligned length |
Identity (normalized by query) |
Identity (normalized by hit) |
Identity (normalized by aligned length) |
E-value |
Homologs to hit |
1 |
8i5m:A |
310 |
310 |
1.0000 |
1.0000 |
1.0000 |
0.0 |
8i5m:B, 8i5m:C, 8i5m:D, 8i5n:A, 8i5n:B, 8i5n:C, 8i5n:D |
2 |
3spg:A |
332 |
311 |
0.4484 |
0.4187 |
0.4469 |
3.59e-96 |
5kuk:A, 5kum:A, 6m84:A, 3spc:A, 3sph:A, 3spi:A |
3 |
4kfm:A |
328 |
306 |
0.4129 |
0.3902 |
0.4183 |
1.55e-89 |
3auw:B, 3auw:D, 3sya:A, 3syo:A, 6xeu:A, 6xeu:D, 6xeu:G, 6xeu:J, 6xev:A, 6xev:E, 6xev:I, 6xev:M, 6xit:A, 6xit:B, 6xit:C, 6xit:D |
4 |
7tys:A |
361 |
309 |
0.4161 |
0.3573 |
0.4175 |
4.27e-85 |
6baa:A, 6baa:D, 6baa:B, 6baa:C, 6c3o:A, 6c3o:B, 6c3o:C, 6c3o:D, 6c3p:A, 6c3p:B, 6c3p:D, 6c3p:C, 6jb1:A, 6jb1:G, 6jb1:C, 6jb1:E, 8ti1:D, 8ti1:A, 8ti1:B, 8ti1:C, 8ti2:D, 8ti2:A, 8ti2:B, 8ti2:C, 5twv:A, 5twv:C, 5twv:E, 5twv:G, 7tys:D, 7tys:B, 7tys:C, 7tyt:A, 7tyt:D, 7tyt:B, 7tyt:C, 7u1e:B, 7u1e:C, 7u1e:D, 7u1e:A, 7u1q:A, 7u1q:B, 7u1q:C, 7u1q:D, 7u1s:A, 7u1s:D, 7u1s:B, 7u1s:C, 7u24:A, 7u24:D, 7u24:B, 7u24:C, 7u6y:A, 7u6y:B, 7u6y:C, 7u6y:D, 7uaa:B, 7uaa:C, 7uaa:D, 7w4p:A, 7w4p:C, 7w4p:E, 7w4p:G, 5ykf:A, 5ykf:C, 5ykf:E, 5ykf:G, 5ykg:A, 5ykg:C, 5ykg:E, 5ykg:G, 5yw8:C, 5yw8:E, 5yw8:G, 5yw8:A, 5yw9:C, 5yw9:E, 5yw9:G, 5yw9:A, 5ywa:A, 5ywa:C, 5ywa:E, 5ywa:G, 5ywb:A, 5ywb:C, 5ywb:E, 5ywb:G, 5ywc:A, 5ywc:C, 5ywc:E, 5ywc:G |
5 |
7mjp:A |
366 |
319 |
0.4129 |
0.3497 |
0.4013 |
8.32e-79 |
7mit:A, 7mit:B, 7mit:C, 7mit:D, 7mjo:A, 7mjo:B, 7mjo:C, 7mjo:D, 7mjp:B, 7mjp:D, 7mjq:A, 7mjq:B, 7mjq:C |
6 |
3syq:A |
292 |
306 |
0.3806 |
0.4041 |
0.3856 |
1.47e-77 |
|
7 |
2wll:B |
266 |
293 |
0.2452 |
0.2857 |
0.2594 |
2.60e-23 |
|
8 |
2x6b:A |
287 |
313 |
0.2645 |
0.2857 |
0.2620 |
6.85e-21 |
7n9k:A, 7n9l:A, 6o9t:A, 6o9u:A, 6o9v:A, 6o9v:B, 2x6a:A, 2x6c:A |
9 |
5hkk:H |
132 |
46 |
0.0548 |
0.1288 |
0.3696 |
0.70 |
5hkk:P |
10 |
5e34:A |
323 |
126 |
0.1194 |
0.1146 |
0.2937 |
5.0 |
5e35:A |
11 |
2wad:C |
607 |
51 |
0.0645 |
0.0329 |
0.3922 |
9.0 |
2wad:A, 2wae:A |