BioLiP

>protein
RRPPWDIARFRPALRVAKLQAPDSVQRKDVRSFPNFQADHFYSENRDMVFVMGGDSQRSELRFLDEWSVRTSSTRRMVGV
LTLPTPLRGMKHFTWMQVAGGSKGKKPLLRLSWHDKREQLRNTMLATVRLNNKSGDAGRFKKIVLGTRPSGRFVADVRVE
RSRLTVRLNGRKLVDEDVGYWTYSTNYFKAGVYVQEGSPDARVVFHGLTVS

The query sequence (length=211) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.

#	Hit	Hit length	Aligned length	Identity (normalized by query)	Identity (normalized by hit)	Identity (normalized by aligned length)	E-value	Homologs to hit
1	7w18:A	212	212	0.9953	0.9906	0.9906	3.66e-153	7w13:A
2	8pcx:A	232	221	0.3033	0.2759	0.2896	3.99e-17	8bjo:A, 8bxz:A, 8p6o:A, 8pc3:A, 8pc8:A, 8pdt:A, 8ped:A, 8qli:A, 8r43:A, 8rbn:A
3	7ncz:A	227	221	0.2986	0.2775	0.2851	4.88e-15	7nm6:A, 7npp:A, 7ny3:A, 7o6h:A, 7oof:A, 7ory:A, 7p25:A, 7p90:A, 7pbf:A
4	7c8f:A	266	234	0.2844	0.2256	0.2564	2.38e-12	7c8f:B
5	7w16:A	264	255	0.3033	0.2424	0.2510	5.15e-12
6	8rd8:dh	64	50	0.0806	0.2656	0.3400	2.3	8rdv:dh, 8rdw:dh
7	2x9o:A	233	36	0.0664	0.0601	0.3889	2.9
8	8w1o:K	1290	70	0.0853	0.0140	0.2571	3.2
9	5uth:A	306	31	0.0569	0.0392	0.3871	3.8	8cci:A, 8ccj:A, 8cck:A, 8ccl:A, 8ccm:A
10	8shj:C	306	37	0.0758	0.0523	0.4324	3.9	8t55:C
11	8shj:A	334	37	0.0758	0.0479	0.4324	4.3	8shj:B, 8t55:A, 8t55:B
12	1j6t:B	85	27	0.0521	0.1294	0.4074	6.9	1poh:A, 1vrc:C, 1vrc:D
13	6ecv:A	286	36	0.0664	0.0490	0.3889	8.0	6ecu:A, 6ecu:B, 6ecv:B, 6ecw:A, 6ecw:B
14	2zaa:A	232	207	0.2275	0.2069	0.2319	8.3	2cws:A, 2zab:A, 2zac:A
15	8bao:A	368	118	0.1517	0.0870	0.2712	9.0	8bao:B

[Back]