BioLiP

>protein
RRNPCKFEIRGHCLNGKRCHFSHNYFEWPPHALLVRQNFMLNRILKSMDRTEEYALGVVGVLESYIGSINNITKQSACVA
MSKLLTELNSDDIKKLRDNEELNSPKIRVYNTVISYIESNRKNNKQTIHLLKRLPADVLKKTIKNTLDIHKSITIN

The query sequence (length=156) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.

#	Hit	Hit length	Aligned length	Identity (normalized by query)	Identity (normalized by hit)	Identity (normalized by aligned length)	E-value	Homologs to hit
1	6pzq:A	157	156	0.9936	0.9873	0.9936	1.48e-112	6pzq:C
2	4c3b:C	178	172	1.0000	0.8764	0.9070	3.42e-111	4c3b:A, 4c3b:B, 4c3b:D, 4c3b:E, 4c3b:F, 4c3b:G, 4c3b:H, 4c3b:I, 4c3b:J, 4c3b:K, 4c3b:L, 4c3b:M, 4c3b:N, 4c3b:O, 4c3b:P, 4c3e:A, 4c3e:B, 4c3e:C, 4c3e:D, 4c3e:E, 4c3e:F, 4c3e:G, 4c3e:H, 4c3e:I, 4c3e:J, 4c3e:K, 4c3e:L, 4c3e:M, 4c3e:N, 4c3e:O, 4c3e:P, 6g0y:F, 6g0y:E, 6g0y:A, 6g0y:C, 6pzq:B, 6pzq:D
3	4cs7:C	172	164	0.3718	0.3372	0.3537	4.23e-34	4cs7:A, 4cs7:B, 4cs7:E, 4cs8:A, 4cs8:B, 4cs8:C, 4cs8:E, 4cs9:A, 4cs9:B, 4cs9:C, 4cs9:E, 4csa:C, 4csa:A, 4csa:B, 4csa:E
4	2cqe:A	98	22	0.0705	0.1122	0.5000	0.92
5	2cqe:A	98	26	0.0641	0.1020	0.3846	9.3
6	2zba:D	391	49	0.1026	0.0409	0.3265	3.5
7	2zba:A	435	49	0.1026	0.0368	0.3265	3.7	2zba:B, 2zba:C
8	3kak:B	437	43	0.1090	0.0389	0.3953	3.9
9	6xr0:M	683	45	0.0833	0.0190	0.2889	4.2
10	3kal:A	470	43	0.1090	0.0362	0.3953	4.3	3kak:A, 3kal:B
11	5gp4:A	441	56	0.0769	0.0272	0.2143	4.4	5gp4:C, 5gp4:B
12	6pwy:B	513	38	0.0897	0.0273	0.3684	5.4	6pwy:A, 6pwy:D, 6pwy:C
13	8ro0:O	342	36	0.0897	0.0409	0.3889	5.6	8ro1:O
14	2d9n:A	77	21	0.0641	0.1299	0.4762	8.4	2rhk:C
15	4ii1:B	139	21	0.0577	0.0647	0.4286	9.0	4ii1:A, 4ii1:C, 4ii1:D

[Back]