RRMKANARERNRMHGLNAALDNLRKVVPCYSKTQKLSKIETLRLAKNYIWALSEILR
The query sequence (length=57) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.
# | Hit | Hit length |
Aligned length |
Identity (normalized by query) |
Identity (normalized by hit) |
Identity (normalized by aligned length) |
E-value | Homologs to hit |
---|---|---|---|---|---|---|---|---|
1 | 2ql2:B | 59 | 57 | 1.0000 | 0.9661 | 1.0000 | 8.90e-37 | 2ql2:D |
2 | 8osb:B | 66 | 57 | 0.4737 | 0.4091 | 0.4737 | 5.10e-11 | |
3 | 2ypa:A | 67 | 56 | 0.4561 | 0.3881 | 0.4643 | 4.61e-10 | 2ypb:A |
4 | 1mdy:A | 68 | 57 | 0.3860 | 0.3235 | 0.3860 | 1.22e-04 | 1mdy:B, 1mdy:C, 1mdy:D |
5 | 7z5i:A | 56 | 54 | 0.3684 | 0.3750 | 0.3889 | 1.77e-04 | 7z5i:B, 7z5k:A, 7z5k:B |
6 | 6od3:A | 62 | 58 | 0.3684 | 0.3387 | 0.3621 | 0.023 | 6od3:B, 6od3:H, 6od3:E, 6od3:F, 6od4:A, 6od4:B, 6od5:A, 6od5:B, 6od5:C, 6od5:D, 8osb:A |
7 | 2ypb:B | 74 | 58 | 0.3509 | 0.2703 | 0.3448 | 0.092 | 2ql2:A, 2ql2:C, 2ypa:B |
8 | 4b18:A | 427 | 24 | 0.1754 | 0.0234 | 0.4167 | 3.7 | 6wx9:A |
9 | 8ffz:C | 797 | 25 | 0.1579 | 0.0113 | 0.3600 | 3.8 | |
10 | 5a43:B | 126 | 44 | 0.2456 | 0.1111 | 0.3182 | 4.4 | 5a43:A, 6b24:A, 6b24:B, 6b2a:A, 6b2a:B, 6b2b:A, 6b2b:B, 6b2d:A, 6b2d:B, 6bx4:A, 6bx4:B, 6bx5:A, 6bx5:B, 5kbn:A, 5kbn:B, 7kk8:A, 7kk8:B, 7kk9:A, 7kk9:B, 7kka:A, 7kka:B, 7kkb:A, 7kkb:B, 7kkr:A, 7kkr:B, 5kom:A, 5kom:B |