RRMANNARERVRVRDINEAFRELGRMCQLHLKAQTKLLILQQAVQVILGLEQQVRE
The query sequence (length=56) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.
# | Hit | Hit length |
Aligned length |
Identity (normalized by query) |
Identity (normalized by hit) |
Identity (normalized by aligned length) |
E-value | Homologs to hit |
---|---|---|---|---|---|---|---|---|
1 | 2ypb:B | 74 | 59 | 0.9821 | 0.7432 | 0.9322 | 1.25e-31 | 2ql2:A, 2ql2:C, 2ypa:B |
2 | 6od3:A | 62 | 59 | 0.8750 | 0.7903 | 0.8305 | 4.51e-27 | 6od3:B, 6od3:H, 6od3:E, 6od3:F, 6od4:A, 6od4:B, 6od5:A, 6od5:B, 6od5:C, 6od5:D, 8osb:A |
3 | 1mdy:A | 68 | 57 | 0.3750 | 0.3088 | 0.3684 | 0.005 | 1mdy:B, 1mdy:C, 1mdy:D |
4 | 2ypa:A | 67 | 49 | 0.3393 | 0.2836 | 0.3878 | 0.013 | 2ypb:A |
5 | 2ql2:B | 59 | 58 | 0.3571 | 0.3390 | 0.3448 | 0.023 | 2ql2:D |
6 | 7z5i:A | 56 | 54 | 0.3571 | 0.3571 | 0.3704 | 0.081 | 7z5i:B, 7z5k:A, 7z5k:B |
7 | 3ubt:Y | 328 | 49 | 0.3393 | 0.0579 | 0.3878 | 0.36 | 1dct:A, 1dct:B, 3ubt:B, 3ubt:A |
8 | 8osk:M | 316 | 47 | 0.2143 | 0.0380 | 0.2553 | 0.92 | 4h10:B, 8osl:M, 8osl:O |
9 | 8fgw:C | 1342 | 50 | 0.2321 | 0.0097 | 0.2600 | 1.2 | 8fh3:C |
10 | 8osb:B | 66 | 25 | 0.1964 | 0.1667 | 0.4400 | 3.3 | |
11 | 3bb8:A | 420 | 21 | 0.1607 | 0.0214 | 0.4286 | 4.2 | 3bb8:B |
12 | 4ho9:A | 294 | 26 | 0.1429 | 0.0272 | 0.3077 | 7.0 | 4ho3:A, 4ho4:A, 4ho5:A, 4ho5:B, 4ho6:A, 4ho8:A, 4ho8:B, 4ho8:C, 4ho8:D, 4ho9:B, 4hoc:A, 4hoc:B |