RRMANNARERLRVRDINEAFKELGRMVQLHLKSDKPQTKLLILHQAVAVILSLEQQVRE
The query sequence (length=59) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.
# | Hit | Hit length |
Aligned length |
Identity (normalized by query) |
Identity (normalized by hit) |
Identity (normalized by aligned length) |
E-value | Homologs to hit |
---|---|---|---|---|---|---|---|---|
1 | 6od3:A | 62 | 59 | 1.0000 | 0.9516 | 1.0000 | 6.06e-37 | 6od3:B, 6od3:H, 6od3:E, 6od3:F, 6od4:A, 6od4:B, 6od5:A, 6od5:B, 6od5:C, 6od5:D, 8osb:A |
2 | 2ypb:B | 74 | 59 | 0.8644 | 0.6892 | 0.8644 | 4.02e-31 | 2ql2:A, 2ql2:C, 2ypa:B |
3 | 2ypa:A | 67 | 50 | 0.3390 | 0.2985 | 0.4000 | 5.98e-04 | 2ypb:A |
4 | 7z5i:A | 56 | 55 | 0.3390 | 0.3571 | 0.3636 | 0.007 | 7z5i:B, 7z5k:A, 7z5k:B |
5 | 2ql2:B | 59 | 59 | 0.3559 | 0.3559 | 0.3559 | 0.020 | 2ql2:D |
6 | 1mdy:A | 68 | 59 | 0.3559 | 0.3088 | 0.3559 | 0.069 | 1mdy:B, 1mdy:C, 1mdy:D |
7 | 8osb:B | 66 | 35 | 0.2542 | 0.2273 | 0.4286 | 0.11 | |
8 | 1q3i:A | 192 | 40 | 0.2034 | 0.0625 | 0.3000 | 0.28 | |
9 | 4ho9:A | 294 | 26 | 0.1525 | 0.0306 | 0.3462 | 3.8 | 4ho3:A, 4ho4:A, 4ho5:A, 4ho5:B, 4ho6:A, 4ho8:A, 4ho8:B, 4ho8:C, 4ho8:D, 4ho9:B, 4hoc:A, 4hoc:B |
10 | 4bqk:A | 424 | 38 | 0.2373 | 0.0330 | 0.3684 | 5.0 | 4b8o:A, 4b8p:A, 4b8p:B, 4bpl:A, 4bqk:B, 2yns:A, 2yns:B |
11 | 7zap:A | 97 | 26 | 0.1525 | 0.0928 | 0.3462 | 6.3 | |
12 | 1epz:A | 183 | 36 | 0.2373 | 0.0765 | 0.3889 | 7.7 |