RQFGHLTRVRHVITYSLSPFEQRAFPHYFSKGIPNVLRRTRACILRVAPPFVAFYLVYTWGTQEFEKSKRKNP
The query sequence (length=73) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.
# | Hit | Hit length |
Aligned length |
Identity (normalized by query) |
Identity (normalized by hit) |
Identity (normalized by aligned length) |
E-value | Homologs to hit |
---|---|---|---|---|---|---|---|---|
1 | 2a06:G | 73 | 73 | 1.0000 | 1.0000 | 1.0000 | 2.15e-50 | 1pp9:G, 1ppj:G |
2 | 7o3e:R | 72 | 72 | 0.8082 | 0.8194 | 0.8194 | 1.10e-40 | |
3 | 3hmz:A | 191 | 36 | 0.1918 | 0.0733 | 0.3889 | 0.41 | |
4 | 4zm6:A | 844 | 23 | 0.1370 | 0.0118 | 0.4348 | 0.51 | 4zm6:B |
5 | 1mo4:A | 324 | 30 | 0.1781 | 0.0401 | 0.4333 | 0.70 | 1g18:A, 1mo3:A, 1mo5:A, 1mo6:A |
6 | 8cub:C | 588 | 46 | 0.1781 | 0.0221 | 0.2826 | 2.6 | 8cub:A, 7r8a:A, 7r8b:A |
7 | 5w7k:A | 274 | 52 | 0.1644 | 0.0438 | 0.2308 | 4.2 | 5w7k:B |
8 | 8pv1:CI | 152 | 39 | 0.1644 | 0.0789 | 0.3077 | 5.1 | 8i9p:CI, 8i9r:CI, 8i9t:CI, 8i9v:CI, 8i9w:CI, 8i9x:CI, 8i9y:CI, 8i9z:CI, 8ia0:CI, 8pv3:CI, 8pv4:CI, 8pv7:CI, 8pvk:CI |
9 | 6kjl:A | 328 | 13 | 0.1096 | 0.0244 | 0.6154 | 7.1 | 2dcj:A, 2dcj:B, 2dck:A, 6kjl:B, 6kka:A, 6kka:B |