RQDSKDRYQYKQYIYRSIGGIVPPEMAETVTANQTAQWEAGFTPYHKLRLAIKEICKTDGIPNIKWGMYIAFGEKLLKSY
LKMKAGSASSDMIAEYINNAISAFSSRTGISQETAQKIADFITSNY
The query sequence (length=126) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.
# | Hit | Hit length |
Aligned length |
Identity (normalized by query) |
Identity (normalized by hit) |
Identity (normalized by aligned length) |
E-value | Homologs to hit |
---|---|---|---|---|---|---|---|---|
1 | 5w7g:B | 126 | 126 | 1.0000 | 1.0000 | 1.0000 | 2.09e-92 | 5w7g:D, 5w7g:F, 5w7g:H, 5w7g:J, 5w7g:L, 5w7g:N, 5w7g:P, 5w7g:R, 5w7g:T, 5w7g:V, 5w7g:X, 5w7g:Z, 5w7g:b, 5w7g:d, 5w7g:f, 5w7g:h, 5w7g:j, 5w7g:l, 5w7g:n, 5w7g:p |
2 | 5w7g:A | 131 | 87 | 0.2698 | 0.2595 | 0.3908 | 3.09e-14 | 5w7g:C, 5w7g:E, 5w7g:G, 5w7g:I, 5w7g:K, 5w7g:M, 5w7g:O, 5w7g:Q, 5w7g:S, 5w7g:U, 5w7g:W, 5w7g:Y, 5w7g:a, 5w7g:c, 5w7g:e, 5w7g:g, 5w7g:i, 5w7g:k, 5w7g:m, 5w7g:o |
3 | 6wq2:A | 154 | 61 | 0.1349 | 0.1104 | 0.2787 | 0.004 | 6wq2:B, 6wq2:C, 6wq2:D, 6wq2:E, 6wq2:F, 6wq2:G, 6wq2:H, 6wq2:I, 6wq2:J, 6wq2:K, 6wq2:L, 6wq2:M, 6wq2:N, 6wq2:P, 6wq2:R, 6wq2:T |
4 | 7txj:A | 153 | 70 | 0.1190 | 0.0980 | 0.2143 | 0.13 | |
5 | 3fed:A | 690 | 59 | 0.1349 | 0.0246 | 0.2881 | 2.0 | 3fec:A, 3fee:A, 3ff3:A |
6 | 6grh:C | 266 | 37 | 0.1032 | 0.0489 | 0.3514 | 7.3 | 6gos:C, 6grg:C, 6gri:C |
7 | 1wn1:A | 356 | 40 | 0.1111 | 0.0393 | 0.3500 | 8.3 | 1wn1:B |