RPSSRVYIVEVLNEFPHDPYAFTQGLVYAENDTLFESTGLYGRSSVRQVALQTGKVENIHKMDDSYFGEGLTLLNEKLYQ
VVWLKNIGFIYDRRTLSNIKNFTHQMKDGWGLATDGKILYGSDGTSILYEIDPHTFKLIKKHNVKYNGHRVIRLNELEYI
NGEVWANIWQTDCIARISAKDGTLLGWILLPNLRKKLIDEGFRDIDVLNGIAWDQENKRIFVTGKLWPKLFEIKLHLVRH
RIPDGYIERHCLNL
The query sequence (length=254) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.
# | Hit | Hit length |
Aligned length |
Identity (normalized by query) |
Identity (normalized by hit) |
Identity (normalized by aligned length) |
E-value | Homologs to hit |
---|---|---|---|---|---|---|---|---|
1 | 2iwa:A | 254 | 254 | 1.0000 | 1.0000 | 1.0000 | 0.0 | 2faw:A, 2faw:B |
2 | 3mbr:X | 236 | 230 | 0.3819 | 0.4110 | 0.4217 | 1.60e-56 | |
3 | 3nol:A | 234 | 235 | 0.3780 | 0.4103 | 0.4085 | 3.11e-52 | 3nom:A, 3nom:B |
4 | 3nok:A | 234 | 231 | 0.3228 | 0.3504 | 0.3550 | 2.66e-39 | 3nok:B |
5 | 8y85:A | 514 | 33 | 0.0433 | 0.0214 | 0.3333 | 0.47 | 8y85:B, 8y86:A |
6 | 6z1p:AR | 274 | 37 | 0.0512 | 0.0474 | 0.3514 | 1.8 | |
7 | 6hyp:A | 2272 | 59 | 0.0630 | 0.0070 | 0.2712 | 6.2 | |
8 | 5jcs:s | 2003 | 59 | 0.0630 | 0.0080 | 0.2712 | 6.4 | |
9 | 7uo3:A | 174 | 34 | 0.0394 | 0.0575 | 0.2941 | 6.9 | 7uma:A, 7uo8:A |
10 | 4yzf:A | 475 | 31 | 0.0472 | 0.0253 | 0.3871 | 9.9 | 4yzf:B, 4yzf:C, 4yzf:D |
11 | 8t45:A | 460 | 31 | 0.0472 | 0.0261 | 0.3871 | 9.9 | 8t3r:A, 8t3u:A, 8t3u:B, 8t44:A, 8t45:B |