RPRLGRLTEETIDIAREVLVEGKSQSDVARERGLSRQRVSSMVKSVVSAANEIPREWQRVEVWLPPNLAEKVRQMEADAK
ADVARKNQLTDAAL
The query sequence (length=94) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.
# | Hit | Hit length |
Aligned length |
Identity (normalized by query) |
Identity (normalized by hit) |
Identity (normalized by aligned length) |
E-value | Homologs to hit |
---|---|---|---|---|---|---|---|---|
1 | 7bcb:B | 97 | 89 | 0.9468 | 0.9175 | 1.0000 | 7.31e-59 | 7bca:A, 7bca:B, 7bcb:A |
2 | 8qa9:C | 107 | 86 | 0.3830 | 0.3364 | 0.4186 | 1.24e-10 | 5clv:A, 5clv:B, 5clv:E, 5clv:F, 5clv:I, 5clv:J, 5clv:M, 5clv:N, 5cm3:A, 5cm3:B, 8qa9:D, 2w7n:A, 2w7n:B |
3 | 7zc0:AAA | 710 | 51 | 0.1809 | 0.0239 | 0.3333 | 0.26 | |
4 | 5zcr:A | 725 | 35 | 0.1489 | 0.0193 | 0.4000 | 0.45 | 5zcr:B |
5 | 3cxm:A | 242 | 47 | 0.1383 | 0.0537 | 0.2766 | 0.79 | |
6 | 5odn:D | 106 | 43 | 0.1596 | 0.1415 | 0.3488 | 3.5 | 5odn:F, 5odn:G, 5odn:B, 5odn:C, 5odn:A, 5odn:E, 5odn:H |
7 | 8q4d:D | 373 | 30 | 0.1277 | 0.0322 | 0.4000 | 4.6 | 8b4h:A, 8b4h:B, 8b4h:C, 8b4h:D, 8q4d:A, 8q4d:B, 8q4d:C |
8 | 6hun:A | 428 | 96 | 0.2766 | 0.0607 | 0.2708 | 7.8 | |
9 | 5frp:A | 677 | 25 | 0.0957 | 0.0133 | 0.3600 | 8.3 | 5frp:B, 5frs:A |
10 | 8xha:A | 401 | 19 | 0.0957 | 0.0224 | 0.4737 | 8.7 | 8i7u:C, 8i7u:F, 8i7u:A, 8i7u:E, 8i7u:B, 8i7u:D, 8xha:B, 8xhd:A, 8xhd:B, 8xhk:C, 8xhk:A, 8xhk:B, 8xhk:E, 8xhk:D, 8xhk:F |
11 | 4zfv:A | 436 | 49 | 0.1596 | 0.0344 | 0.3061 | 8.8 | 5bsb:A, 5bvc:A, 5tkr:A, 4yh5:A, 4yh5:B, 4zfv:B, 4zlu:A, 4zlu:B |