RPLSRFWEWGKNIVCVGRNYADHVREMRSAVLSEPVLFLKPSTAYAPEGSPILMPAYTRNLHHELELGVVMGKRCRAVPE
AAAMDYVGGYALCLDMTARDVQDECKKKGLPWTLAKSFTASCPVSAFVPKEKIPDPHKLKLWLKVNGELRQEGETSSMIF
SIPYIISYVSKIITLEEGDIILTGTPKGVGPVKENDEIEAGIHGLVSMTFKVEKP
The query sequence (length=215) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.
# | Hit | Hit length |
Aligned length |
Identity (normalized by query) |
Identity (normalized by hit) |
Identity (normalized by aligned length) |
E-value | Homologs to hit |
---|---|---|---|---|---|---|---|---|
1 | 6fog:A | 218 | 215 | 1.0000 | 0.9862 | 1.0000 | 9.64e-162 | 6fog:C, 6fog:G, 6fog:E, 6fog:F, 6fog:H, 6fog:D, 6fog:B, 6foh:A, 6foh:B, 1saw:A, 1saw:B |
2 | 6sbi:A | 216 | 214 | 0.8837 | 0.8796 | 0.8879 | 8.04e-146 | 6sbi:B, 6sbi:C, 6sbi:D, 6sbj:A, 6sbj:B, 6sbj:C, 6sbj:D |
3 | 1nr9:A | 211 | 201 | 0.4140 | 0.4218 | 0.4428 | 2.09e-52 | 1nr9:B, 1nr9:C, 1nr9:D |
4 | 3v77:A | 224 | 202 | 0.3767 | 0.3616 | 0.4010 | 6.69e-50 | 3v77:B, 3v77:C, 3v77:D, 3v77:E, 3v77:F |
5 | 1nkq:A | 247 | 242 | 0.4140 | 0.3603 | 0.3678 | 1.40e-46 | 1nkq:B, 1nkq:C, 1nkq:D, 1nkq:E, 1nkq:F |
6 | 6j5y:A | 233 | 207 | 0.3581 | 0.3305 | 0.3720 | 1.05e-43 | |
7 | 3qdf:A | 252 | 202 | 0.3581 | 0.3056 | 0.3812 | 5.21e-41 | |
8 | 1gtt:A | 421 | 178 | 0.3628 | 0.1853 | 0.4382 | 5.80e-41 | 1gtt:B, 1gtt:C, 1gtt:D, 1i7o:A, 1i7o:B, 1i7o:C, 1i7o:D |
9 | 1gtt:A | 421 | 201 | 0.2279 | 0.1164 | 0.2438 | 4.57e-09 | 1gtt:B, 1gtt:C, 1gtt:D, 1i7o:A, 1i7o:B, 1i7o:C, 1i7o:D |
10 | 8sky:B | 303 | 184 | 0.3674 | 0.2607 | 0.4293 | 6.97e-40 | 8sky:A, 8sut:A, 8sut:B, 8suu:A, 8suu:B |
11 | 8gsr:A | 290 | 211 | 0.3628 | 0.2690 | 0.3697 | 2.30e-38 | 8gsr:B, 8gsr:C, 8gsr:D, 8gst:A, 8gst:B, 8gst:C, 8gst:D |
12 | 6iym:A | 277 | 211 | 0.3581 | 0.2780 | 0.3649 | 2.84e-37 | 6iym:B |
13 | 6jvw:B | 264 | 206 | 0.3302 | 0.2689 | 0.3447 | 1.99e-32 | 6jvw:A |
14 | 6j5x:A | 280 | 183 | 0.3163 | 0.2429 | 0.3716 | 1.01e-30 | 6j5x:B |
15 | 6v77:B | 279 | 181 | 0.2930 | 0.2258 | 0.3481 | 7.57e-29 | 6v77:A |
16 | 4dbh:A | 269 | 200 | 0.3163 | 0.2528 | 0.3400 | 8.90e-27 | 4dbf:A, 4dbf:B, 4dbh:B |
17 | 3r6o:A | 265 | 219 | 0.3209 | 0.2604 | 0.3151 | 2.60e-22 | |
18 | 8tdi:G | 386 | 73 | 0.1023 | 0.0570 | 0.3014 | 4.8 | 8tdi:L, 8tdi:J, 8tdi:A, 8tdi:C, 8tdi:D, 8tdi:E, 8tdi:F, 8tdi:H, 8tdi:I, 8tdi:B, 8tdi:K |
19 | 6h0n:A | 377 | 139 | 0.1674 | 0.0955 | 0.2590 | 9.8 | 6h0n:B, 6h0p:A, 6h0p:B |