RPKMTPEQMAKEMSEFLSRGPAVLATKAAAGTKKYDLSKWKYAELRDTINTSCDIELLAACREEFHRRLKVYHAWKSKNK
KR
The query sequence (length=82) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.
# | Hit | Hit length |
Aligned length |
Identity (normalized by query) |
Identity (normalized by hit) |
Identity (normalized by aligned length) |
E-value | Homologs to hit |
---|---|---|---|---|---|---|---|---|
1 | 6e5n:B | 82 | 82 | 1.0000 | 1.0000 | 1.0000 | 1.54e-57 | |
2 | 8w41:A | 1162 | 59 | 0.6341 | 0.0448 | 0.8814 | 2.38e-30 | 4dbr:A, 4e7s:A, 4e7s:B, 4e7z:A, 4e7z:B, 5o2l:A, 4pfo:A, 4pfp:A, 4pfp:C, 4pjl:A, 4pjm:A, 4pjn:A, 4pk4:A, 2v26:A |
3 | 6jmb:A | 374 | 30 | 0.1707 | 0.0374 | 0.4667 | 0.63 | |
4 | 5vyz:C | 1083 | 50 | 0.1829 | 0.0139 | 0.3000 | 4.7 | 5vyw:A, 5vyw:B, 5vyw:C, 5vz0:C |
5 | 5vyz:A | 1144 | 50 | 0.1829 | 0.0131 | 0.3000 | 4.7 | 5vyw:D, 5vyz:B, 5vyz:D, 5vz0:A, 5vz0:B, 5vz0:D, 7zyy:A, 7zyy:C, 7zyy:B, 7zyy:D, 7zyz:A, 7zz0:A, 7zz1:A, 7zz2:A, 7zz3:A, 7zz3:C, 7zz3:B, 7zz3:D, 7zz4:A, 7zz5:A, 7zz6:D, 7zz6:A, 7zz8:A, 7zz8:C, 7zz8:D, 7zz8:B |
6 | 3zx1:A | 471 | 37 | 0.1585 | 0.0276 | 0.3514 | 8.3 | |
7 | 5xq3:A | 901 | 74 | 0.2927 | 0.0266 | 0.3243 | 8.9 | 5xq3:B, 5xqg:A, 5xqg:B, 5xqg:C, 5xqg:D, 5xqg:E, 5xqg:F, 5xqg:G, 5xqg:H, 5xqj:A, 5xqj:B, 5xqj:C, 5xqj:D, 5xqj:E, 5xqj:F, 5xqj:G, 5xqj:H, 5xqo:A, 5xqo:B |
8 | 8bpo:t2 | 418 | 29 | 0.1341 | 0.0263 | 0.3793 | 9.5 | |
9 | 1qdb:A | 473 | 40 | 0.1463 | 0.0254 | 0.3000 | 9.7 | 1qdb:B, 1qdb:C |