Home Research COVID-19 Services Publications People Teaching Job Opening News Forum --> -->
Online Services

●I-TASSER ●I-TASSER-MTD ●C-I-TASSER ●CR-I-TASSER ●QUARK ●C-QUARK ●LOMETS ●MUSTER ●CEthreader ●SEGMER ●DeepFold ●DeepFoldRNA ●FoldDesign ●COFACTOR ●COACH ●MetaGO ●TripletGO ●IonCom ●FG-MD ●ModRefiner ●REMO ●DEMO ●DEMO-EM ●DMFold ●SPRING ●COTH ●Threpp ●PEPPI ●BSpred ●ANGLOR ●EDock ●BSP-SLIM ●SAXSTER ●FUpred ●ThreaDom ●ThreaDomEx ●EvoDesign ●BindProf ●BindProfX ●SSIPe ●GPCR-I-TASSER ●MAGELLAN ●ResQ ●STRUM ●DAMpred

●TM-score ●TM-align ●US-align ●MM-align ●RNA-align ●NW-align ●LS-align ●EDTSurf ●MVP ●MVP-Fit ●SPICKER ●HAAD ●PSSpred ●3DRobot ●MR-REX ●I-TASSER-MR ●SVMSEQ ●NeBcon ●ResPRE ●TripletRes ●DeepPotential ●WDL-RF ●ATPbind ●DockRMSD ●DeepMSA ●FASPR ●EM-Refiner ●GPU-I-TASSER

●BioLiP ●E. coli ●GLASS ●GPCR-HGmod ●GPCR-RD ●GPCR-EXP ●Tara-3D ●TM-fold ●DECOYS ●POTENTIAL ●RW/RWplus ●EvoEF ●HPSF ●THE-DB ●ADDRESS ●Alpaca-Antibody ●CASP7 ●CASP8 ●CASP9 ●CASP10 ●CASP11 ●CASP12 ●CASP13 ●CASP14

BioLiP
>protein
RPIHPGEILRDEFLMEFDISPAALARALKVSAPTVNDIVREQRGISADMAIRLGRYFDTSAQFWMNLQSEYSLATAYAAN
GKQIEHEIEPLL

The query sequence (length=92) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.

# Hit Hit
length 		Aligned
length 		Identity
(normalized by query) 		Identity
(normalized by hit) 		Identity (normalized
by aligned length) 		E-value Homologs
to hit
1 7csy:B 97 91 0.9891 0.9381 1.0000 1.22e-64 7csw:B, 7csy:A, 7csy:C, 7csy:D, 6jpi:A, 6jpi:B, 6jpi:C, 6jpi:D, 6lb3:A, 6lb3:B, 6lb3:G, 6lb3:H, 6lb3:C, 6lb3:D, 6lb3:E, 6lb3:F
2 6fix:B 99 92 0.5435 0.5051 0.5435 2.66e-31 6fix:A, 6fix:D, 6fix:E
3 2icp:A 87 73 0.2717 0.2874 0.3425 2.08e-09
4 6chv:D 91 87 0.2609 0.2637 0.2759 1.32e-06 6chv:A, 6chv:C, 6chv:B, 6chv:G, 6chv:H
5 7tbv:A 682 51 0.1739 0.0235 0.3137 0.32 7tbv:B, 7tbv:C, 7tbv:D
6 2fva:A 82 54 0.1630 0.1829 0.2778 0.73
7 7shw:B 259 42 0.1413 0.0502 0.3095 4.7 7shw:A

[Back]
Reference:
  • Chengxin Zhang, Xi Zhang, Peter L Freddolino, and Yang Zhang. BioLiP2: an updated structure database for biologically relevent ligand-protein interactions, Nucleic Acids Research, gkad630 (2023).
  • Jianyi Yang, Ambrish Roy, and Yang Zhang. BioLiP: a semi-manually curated database for biologically relevant ligand-protein interactions, Nucleic Acids Research, 41: D1096-D1103 (2013) (download the PDF file).

    • yangzhanglabumich.edu | (734) 647-1549 | 100 Washtenaw Avenue, Ann Arbor, MI 48109-2218