BioLiP

>protein
RPEDLGTGLLEALLRGDLAGAEALFRRGLRFWGPEGVLEHLLLPVLREVGEAWHRGEIGVAEEHLASTFLRARLQELLDL
AGFPPGPPVLVTTPPGERHEIGAMLAAYHLRRKGVPALYLGPDTPLPDLRALARRLGAGAVVLSAVLSEPLRALPDGALK
DLAPRVFLGGQGAGPEEARRLGAEYMEDLKGLAEALWLP

The query sequence (length=199) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.

#	Hit	Hit length	Aligned length	Identity (normalized by query)	Identity (normalized by hit)	Identity (normalized by aligned length)	E-value	Homologs to hit
1	5c8d:E	280	199	1.0000	0.7107	1.0000	2.68e-133	8c31:A, 8c31:B, 8c31:C, 8c31:D, 8c32:A, 8c32:B, 8c32:C, 8c32:D, 8c33:A, 8c33:B, 8c33:C, 8c33:D, 8c34:A, 8c34:B, 8c34:C, 8c34:D, 8c35:A, 8c35:B, 8c35:C, 8c35:D, 8c36:A, 8c36:B, 8c36:C, 8c36:D, 8c37:A, 8c37:B, 8c37:C, 8c37:D, 8c73:A, 8c73:B, 8c73:C, 8c73:D, 8c76:A, 8c76:B, 8c76:C, 8c76:D, 5c8a:A, 5c8a:B, 5c8a:C, 5c8a:D, 5c8d:A, 5c8d:B, 5c8d:C, 5c8d:D, 5c8d:F, 5c8d:G, 5c8d:H, 5c8e:A, 5c8e:B, 5c8e:C, 5c8e:E, 5c8e:F, 5c8e:G, 5c8e:D, 5c8e:H, 5c8f:A, 3whp:A
2	7te2:A	205	71	0.1558	0.1512	0.4366	3.02e-10
3	8j2y:A	327	154	0.2462	0.1498	0.3182	4.49e-07	8j2y:B
4	8j2x:A	337	184	0.2965	0.1751	0.3207	3.15e-04	8j2w:A, 8j2w:B
5	4jgi:B	206	147	0.1809	0.1748	0.2449	0.006	4jgi:A
6	4z17:A	424	98	0.1658	0.0778	0.3367	0.062	4yws:A, 4z17:B, 4z1y:A, 4z1y:B
7	3c9h:B	339	64	0.0955	0.0560	0.2969	0.55	3c9h:A
8	7xcn:P	215	104	0.1206	0.1116	0.2308	0.69	7xcn:M, 7xcn:N, 7xcn:O, 7xcn:Q, 7xcn:R
9	2fge:A	979	77	0.1206	0.0245	0.3117	2.6	2fge:B
10	8swu:A	269	35	0.0804	0.0595	0.4571	2.9	8swu:B, 8swu:C
11	7acs:A	140	75	0.1156	0.1643	0.3067	4.5	7act:A, 8iv3:D, 8j6x:A, 8j6x:D, 6vyo:A, 6vyo:B, 6vyo:C, 6vyo:D, 6wkp:B, 6wkp:C, 6wkp:D, 7xwz:A, 7xwz:B, 7xx1:A, 7xx1:B, 7xx1:C, 7xx1:D
12	5af7:B	391	131	0.1457	0.0742	0.2214	6.3	5af7:A, 5ahs:A, 5ahs:B, 5ahs:C, 5ahs:E, 5ahs:F, 5ahs:D
13	8ppg:B	243	41	0.0754	0.0617	0.3659	8.7

[Back]