RNSAKDIRTEERARVQLGNVVTAAALHGGIRISDQTTNSVKTVVGKGESRVLIGNEYGGKGFWDNHHHHHH
The query sequence (length=71) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.
# | Hit | Hit length |
Aligned length |
Identity (normalized by query) |
Identity (normalized by hit) |
Identity (normalized by aligned length) |
E-value | Homologs to hit |
---|---|---|---|---|---|---|---|---|
1 | 2lbu:B | 71 | 71 | 0.9859 | 0.9859 | 0.9859 | 1.22e-46 | 2lbu:C, 2lbu:D, 2mus:B, 2mus:C, 2mus:D |
2 | 8c9e:A | 921 | 26 | 0.1408 | 0.0109 | 0.3846 | 6.7 | 8c9f:A, 8c9g:A, 8c9g:B |
3 | 4hlu:A | 265 | 48 | 0.1831 | 0.0491 | 0.2708 | 9.2 | 4hlu:B, 4zir:A |