RNSAKDIRTEERARVQLGNVVTAAALHGGIRISDQTTNSVETVVGKGESRVLIGNEYGGKGFWDNHHHHHH
The query sequence (length=71) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.
# | Hit | Hit length |
Aligned length |
Identity (normalized by query) |
Identity (normalized by hit) |
Identity (normalized by aligned length) |
E-value | Homologs to hit |
---|---|---|---|---|---|---|---|---|
1 | 2lbu:B | 71 | 71 | 1.0000 | 1.0000 | 1.0000 | 3.38e-47 | 2lbu:C, 2lbu:D, 2mus:B, 2mus:C, 2mus:D |
2 | 4gxq:A | 506 | 29 | 0.1690 | 0.0237 | 0.4138 | 2.2 | 4fut:A, 4gxq:B, 4gxq:C, 4gxr:A |
3 | 5y6p:l4 | 172 | 25 | 0.1408 | 0.0581 | 0.4000 | 5.1 | 5y6p:g4, 5y6p:c4, 5y6p:e4, 5y6p:h4, 5y6p:j4, 5y6p:e5, 5y6p:l5, 5y6p:g5, 5y6p:c5, 5y6p:h5, 5y6p:j5, 5y6p:W8, 5y6p:Y8, 5y6p:f9, 5y6p:l9, 5y6p:h9, 5y6p:j9, 5y6p:ab, 5y6p:ad, 5y6p:af, 5y6p:al, 5y6p:ah, 5y6p:aj, 5y6p:bb, 5y6p:bf, 5y6p:bd, 5y6p:bh, 5y6p:bj, 5y6p:bl, 5y6p:cf, 5y6p:cb, 5y6p:cd, 5y6p:ch, 5y6p:cj, 5y6p:cl |
4 | 8c9e:A | 921 | 26 | 0.1408 | 0.0109 | 0.3846 | 6.2 | 8c9f:A, 8c9g:A, 8c9g:B |
5 | 5vb0:C | 143 | 38 | 0.1972 | 0.0979 | 0.3684 | 9.0 | 5vb0:A, 5vb0:B, 5vb0:D, 5vb0:E, 5vb0:F, 5vb0:G, 5vb0:H, 5wep:A, 5wep:B |
6 | 4hlu:A | 265 | 48 | 0.1831 | 0.0491 | 0.2708 | 9.0 | 4hlu:B, 4zir:A |