RNPCKFEIRGHCLNGKRCHFSHNYFEWPPHALLVRQNFMLNRILKSMDKTEEYALGVVGVLESYIGSINNITKQSACVAM
SKLLTELNSDDIKKLRDNEELNSPKIRVYNTVISYIESNRKNNKQTIHLLKRLPADVLKKTIKNTLDIHKSITIN
The query sequence (length=155) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.
# | Hit | Hit length |
Aligned length |
Identity (normalized by query) |
Identity (normalized by hit) |
Identity (normalized by aligned length) |
E-value | Homologs to hit |
---|---|---|---|---|---|---|---|---|
1 | 6pzq:A | 157 | 155 | 0.9935 | 0.9809 | 0.9935 | 9.36e-112 | 6pzq:C |
2 | 4c3b:C | 178 | 171 | 1.0000 | 0.8708 | 0.9064 | 3.33e-110 | 4c3b:A, 4c3b:B, 4c3b:D, 4c3b:E, 4c3b:F, 4c3b:G, 4c3b:H, 4c3b:I, 4c3b:J, 4c3b:K, 4c3b:L, 4c3b:M, 4c3b:N, 4c3b:O, 4c3b:P, 4c3e:A, 4c3e:B, 4c3e:C, 4c3e:D, 4c3e:E, 4c3e:F, 4c3e:G, 4c3e:H, 4c3e:I, 4c3e:J, 4c3e:K, 4c3e:L, 4c3e:M, 4c3e:N, 4c3e:O, 4c3e:P, 6g0y:F, 6g0y:E, 6g0y:A, 6g0y:C, 6pzq:B, 6pzq:D |
3 | 4cs7:C | 172 | 161 | 0.3613 | 0.3256 | 0.3478 | 8.24e-33 | 4cs7:A, 4cs7:B, 4cs7:E, 4cs8:A, 4cs8:B, 4cs8:C, 4cs8:E, 4cs9:A, 4cs9:B, 4cs9:C, 4cs9:E, 4csa:C, 4csa:A, 4csa:B, 4csa:E |
4 | 2cqe:A | 98 | 22 | 0.0710 | 0.1122 | 0.5000 | 0.96 | |
5 | 6xr0:M | 683 | 45 | 0.0903 | 0.0205 | 0.3111 | 1.9 | |
6 | 2zba:D | 391 | 49 | 0.1032 | 0.0409 | 0.3265 | 2.8 | |
7 | 2zba:A | 435 | 49 | 0.1032 | 0.0368 | 0.3265 | 2.9 | 2zba:B, 2zba:C |
8 | 3kak:B | 437 | 43 | 0.1097 | 0.0389 | 0.3953 | 3.8 | |
9 | 8ro0:O | 342 | 51 | 0.1097 | 0.0497 | 0.3333 | 4.3 | 8ro1:O |
10 | 3kal:A | 470 | 43 | 0.1097 | 0.0362 | 0.3953 | 4.3 | 3kak:A, 3kal:B |
11 | 5gp4:A | 441 | 56 | 0.0774 | 0.0272 | 0.2143 | 5.0 | 5gp4:C, 5gp4:B |
12 | 6pwy:B | 513 | 38 | 0.0903 | 0.0273 | 0.3684 | 5.6 | 6pwy:A, 6pwy:D, 6pwy:C |
13 | 2d9n:A | 77 | 21 | 0.0645 | 0.1299 | 0.4762 | 8.0 | 2rhk:C |
14 | 4ii1:B | 139 | 21 | 0.0581 | 0.0647 | 0.4286 | 8.5 | 4ii1:A, 4ii1:C, 4ii1:D |
15 | 1xkv:B | 519 | 43 | 0.0903 | 0.0270 | 0.3256 | 8.9 | 1j3b:A, 1j3b:B, 2pc9:A, 2pc9:B, 2pc9:C, 2pc9:D, 1xkv:A |