RNPCKFEIRGHCLNGKRCHFSHNYFEWPPHALLVRQNFMLNRILKSMDKAAELDRTEEYALGVVGVLESYIGSINNITKQ
SACVAMSKLLTELNSDDIKKLRDNEELNSPKIRVYNTVISYIESNRKNNKQTIHLLKRLPADVLKKTIKNTLDIHKSITI
N
The query sequence (length=161) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.
# | Hit | Hit length |
Aligned length |
Identity (normalized by query) |
Identity (normalized by hit) |
Identity (normalized by aligned length) |
E-value | Homologs to hit |
---|---|---|---|---|---|---|---|---|
1 | 4c3b:C | 178 | 171 | 1.0000 | 0.9045 | 0.9415 | 5.86e-116 | 4c3b:A, 4c3b:B, 4c3b:D, 4c3b:E, 4c3b:F, 4c3b:G, 4c3b:H, 4c3b:I, 4c3b:J, 4c3b:K, 4c3b:L, 4c3b:M, 4c3b:N, 4c3b:O, 4c3b:P, 4c3e:A, 4c3e:B, 4c3e:C, 4c3e:D, 4c3e:E, 4c3e:F, 4c3e:G, 4c3e:H, 4c3e:I, 4c3e:J, 4c3e:K, 4c3e:L, 4c3e:M, 4c3e:N, 4c3e:O, 4c3e:P, 6g0y:F, 6g0y:E, 6g0y:A, 6g0y:C, 6pzq:B, 6pzq:D |
2 | 6pzq:A | 157 | 161 | 0.9565 | 0.9809 | 0.9565 | 6.63e-111 | 6pzq:C |
3 | 4cs7:C | 172 | 161 | 0.3727 | 0.3488 | 0.3727 | 2.94e-36 | 4cs7:A, 4cs7:B, 4cs7:E, 4cs8:A, 4cs8:B, 4cs8:C, 4cs8:E, 4cs9:A, 4cs9:B, 4cs9:C, 4cs9:E, 4csa:C, 4csa:A, 4csa:B, 4csa:E |
4 | 6xr0:M | 683 | 46 | 0.0994 | 0.0234 | 0.3478 | 0.40 | |
5 | 2cqe:A | 98 | 56 | 0.1118 | 0.1837 | 0.3214 | 0.56 | |
6 | 8ro0:O | 342 | 51 | 0.1118 | 0.0526 | 0.3529 | 1.0 | 8ro1:O |
7 | 8ch6:U | 295 | 90 | 0.1242 | 0.0678 | 0.2222 | 2.6 | 7a5p:P, 8c6j:M, 6ff4:P, 6ff7:P, 9fmd:O, 8i0p:O, 8i0r:O, 8i0s:O, 8i0t:O, 8i0u:O, 8i0v:O, 8i0w:O, 6icz:O, 6id0:O, 6id1:O, 5mqf:P, 6qdv:M, 7qtt:U, 8ro2:O, 7w59:O, 7w5a:O, 7w5b:O, 5xjc:O, 5yzg:O, 5z56:O, 5z57:O, 6zym:P |
8 | 2zba:D | 391 | 49 | 0.0994 | 0.0409 | 0.3265 | 3.1 | |
9 | 2zba:A | 435 | 49 | 0.0994 | 0.0368 | 0.3265 | 3.2 | 2zba:B, 2zba:C |
10 | 5gp4:A | 441 | 33 | 0.0621 | 0.0227 | 0.3030 | 4.3 | 5gp4:C, 5gp4:B |
11 | 3kak:B | 437 | 43 | 0.1056 | 0.0389 | 0.3953 | 4.6 | |
12 | 3kal:A | 470 | 43 | 0.1056 | 0.0362 | 0.3953 | 4.9 | 3kak:A, 3kal:B |
13 | 6pwy:B | 513 | 38 | 0.0870 | 0.0273 | 0.3684 | 6.5 | 6pwy:A, 6pwy:D, 6pwy:C |
14 | 2d9n:A | 77 | 21 | 0.0621 | 0.1299 | 0.4762 | 8.5 | 2rhk:C |
15 | 4ii1:B | 139 | 21 | 0.0559 | 0.0647 | 0.4286 | 8.6 | 4ii1:A, 4ii1:C, 4ii1:D |