RNPCKFEIRGHCLNGKRCHFSHNYFEWPPHALLVRQNFMLNRILKSMDEYALGVVGVLESYIGSINNITKQSACVAMSKL
LTELNSDDIKKLRDNEELNSPKIRVYNTVISYIESNRKNNKQTIHLLKRLPADVLKKTIKNTLDIHKSITIN
The query sequence (length=152) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.
# | Hit | Hit length |
Aligned length |
Identity (normalized by query) |
Identity (normalized by hit) |
Identity (normalized by aligned length) |
E-value | Homologs to hit |
---|---|---|---|---|---|---|---|---|
1 | 6pzq:A | 157 | 154 | 1.0000 | 0.9682 | 0.9870 | 4.45e-110 | 6pzq:C |
2 | 4c3b:C | 178 | 171 | 1.0000 | 0.8539 | 0.8889 | 1.28e-107 | 4c3b:A, 4c3b:B, 4c3b:D, 4c3b:E, 4c3b:F, 4c3b:G, 4c3b:H, 4c3b:I, 4c3b:J, 4c3b:K, 4c3b:L, 4c3b:M, 4c3b:N, 4c3b:O, 4c3b:P, 4c3e:A, 4c3e:B, 4c3e:C, 4c3e:D, 4c3e:E, 4c3e:F, 4c3e:G, 4c3e:H, 4c3e:I, 4c3e:J, 4c3e:K, 4c3e:L, 4c3e:M, 4c3e:N, 4c3e:O, 4c3e:P, 6g0y:F, 6g0y:E, 6g0y:A, 6g0y:C, 6pzq:B, 6pzq:D |
3 | 4cs7:C | 172 | 161 | 0.3618 | 0.3198 | 0.3416 | 5.24e-31 | 4cs7:A, 4cs7:B, 4cs7:E, 4cs8:A, 4cs8:B, 4cs8:C, 4cs8:E, 4cs9:A, 4cs9:B, 4cs9:C, 4cs9:E, 4csa:C, 4csa:A, 4csa:B, 4csa:E |
4 | 2cqe:A | 98 | 22 | 0.0724 | 0.1122 | 0.5000 | 1.0 | |
5 | 5gp4:A | 441 | 37 | 0.0658 | 0.0227 | 0.2703 | 1.3 | 5gp4:C, 5gp4:B |
6 | 2zba:D | 391 | 49 | 0.1053 | 0.0409 | 0.3265 | 2.8 | |
7 | 2zba:A | 435 | 49 | 0.1053 | 0.0368 | 0.3265 | 3.1 | 2zba:B, 2zba:C |
8 | 3kak:B | 437 | 43 | 0.1118 | 0.0389 | 0.3953 | 3.7 | |
9 | 3kal:A | 470 | 43 | 0.1118 | 0.0362 | 0.3953 | 3.9 | 3kak:A, 3kal:B |
10 | 8dmf:A | 718 | 129 | 0.1908 | 0.0404 | 0.2248 | 4.0 | 7uvp:A |
11 | 8ro0:O | 342 | 36 | 0.0921 | 0.0409 | 0.3889 | 4.8 | 8ro1:O |
12 | 6pwy:B | 513 | 38 | 0.0921 | 0.0273 | 0.3684 | 5.3 | 6pwy:A, 6pwy:D, 6pwy:C |
13 | 2d9n:A | 77 | 21 | 0.0658 | 0.1299 | 0.4762 | 7.7 | 2rhk:C |
14 | 4ii1:B | 139 | 21 | 0.0592 | 0.0647 | 0.4286 | 8.3 | 4ii1:A, 4ii1:C, 4ii1:D |
15 | 4pxb:A | 423 | 53 | 0.1118 | 0.0402 | 0.3208 | 8.4 | 4pxb:B, 4pxc:A, 4pxc:B, 4pxe:A, 4pxe:B |
16 | 6dnh:C | 117 | 21 | 0.0658 | 0.0855 | 0.4762 | 9.4 | 8e3i:C, 8e3q:C, 6fuw:C, 8r8r:C, 2rhk:D, 6urg:C, 6uro:C |