RNMTPFTYFSLPMQKLFLRNQAAVRNKPYAKYFRSEMRVPLSAVRKIQQGPMALEDTLTPSIEDINRLLEPDFVSEESGY
ALLPGPMAYVQSRKFFPGCTAQMFKWWFIWHPAESERYTLWFPYAHVSNPCVHHQRLRDESLSFEERLYGNTFCASEYVG
DRLMHLHIDFQQPASLGLNTDLYREAKIDGSVSALMSLADHPEVPVSLMVHLFKEVPDGMYLTSRYWVGAHPSMARFPGA
EKAASLLKENGFGEAELETLAYEFAVHDMCEFNHLASFLPDLYREFGT
The query sequence (length=288) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.
# | Hit | Hit length |
Aligned length |
Identity (normalized by query) |
Identity (normalized by hit) |
Identity (normalized by aligned length) |
E-value | Homologs to hit |
---|---|---|---|---|---|---|---|---|
1 | 3hwp:A | 288 | 288 | 1.0000 | 1.0000 | 1.0000 | 0.0 | 3hwp:B |
2 | 5xe5:A | 280 | 283 | 0.3715 | 0.3821 | 0.3781 | 1.20e-56 | 5xe5:B, 5xey:B |
3 | 8b4j:O | 125 | 54 | 0.0660 | 0.1520 | 0.3519 | 0.093 | |
4 | 4aub:F | 298 | 51 | 0.0590 | 0.0570 | 0.3333 | 0.95 | 4aub:E, 4aub:H |
5 | 4aub:B | 335 | 51 | 0.0590 | 0.0507 | 0.3333 | 1.0 | 4aub:A, 4aub:C, 4aub:G, 3n6q:D |
6 | 6go1:A | 318 | 27 | 0.0382 | 0.0346 | 0.4074 | 4.0 | 6go1:B |
7 | 4zox:A | 379 | 84 | 0.0694 | 0.0528 | 0.2381 | 9.8 |