BioLiP

>protein
RNLRVLLDTAIPPSFCDTVSSVLLDDFNMVSLIRTSPADSLATIKQDNAEIDIAITIDEELKISRFNQCVLGYTKAFVVA
HPQHPLCNASLHSIASLANYRQISLGSRSGQHSNLLRPVSDKVLFVENFDDMLRLVEAGVGWGIAPHYFVEERLRNGTLA
VLSELYEPGGIDTKVYCYYNTALESERSFLRFLESARQRLRELGRQRF

The query sequence (length=208) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.

#	Hit	Hit length	Aligned length	Identity (normalized by query)	Identity (normalized by hit)	Identity (normalized by aligned length)	E-value	Homologs to hit
1	6yiz:A	211	208	1.0000	0.9858	1.0000	2.95e-155	6b8a:A, 6b8a:B, 4jvd:A, 4jvi:A, 7nbw:A, 7o2t:AAA, 7o2u:AAA, 7p4u:A, 8q5k:A, 8q5l:A, 6q7u:A, 6q7v:A, 6q7v:B, 6q7w:A, 7qa0:A, 7qa0:B, 7qa3:A, 7qa3:B, 7qav:A, 7qav:B, 6tpr:A, 6yiz:B, 6yz3:AAA, 6z07:AAA, 6z17:AAA, 6z5k:AAA
2	3fd3:A	207	69	0.1058	0.1063	0.3188	0.62
3	6xtv:B	290	69	0.1058	0.0759	0.3188	0.66
4	2wle:C	211	106	0.1394	0.1374	0.2736	2.5	2wle:A, 2wle:B, 2wlf:A, 2wlf:C, 2wlf:B, 2wlg:A, 2wlg:C, 2wlg:B
5	3e49:A	307	49	0.0865	0.0586	0.3673	3.5	3e49:B, 3e49:C, 3e49:D
6	6gbn:B	435	56	0.0769	0.0368	0.2857	4.2	6gbn:A, 6gbn:C, 6gbn:D
7	7yh2:A	156	32	0.0673	0.0897	0.4375	4.3	7yh2:B
8	4hnv:B	1033	112	0.1538	0.0310	0.2857	4.8	8gk8:D
9	3bg5:B	1074	112	0.1538	0.0298	0.2857	5.2	3bg5:D, 8gk8:C, 3hb9:B, 3hb9:D, 3hbl:B, 3hbl:D, 4hnt:B, 4hnt:D, 4hnu:B, 4hnu:D, 4hnv:D, 3ho8:A, 3ho8:C, 3ho8:B
10	1umg:A	359	114	0.1298	0.0752	0.2368	5.4	3r1m:A
11	3bg5:A	1137	112	0.1538	0.0281	0.2857	5.5	3bg5:C, 8gk8:A, 8gk8:B, 3hb9:A, 3hb9:C, 3hbl:A, 3hbl:C, 4hnt:A, 4hnt:C, 4hnu:A, 4hnu:C, 4hnv:A, 4hnv:C
12	3ho8:D	934	112	0.1538	0.0343	0.2857	6.2
13	5vsu:A	387	142	0.1731	0.0930	0.2535	10.0	6aso:A, 2kh9:A, 4n0t:A, 5tf6:A, 5tf6:C
14	6cw3:G	92	52	0.0769	0.1739	0.3077	10.0

[Back]