RNLRVLLDTAIPPSFCDTVSSVLLDDFNMVSLIRTSPADSLATIKQDNAEIDIAITIDEELKISRFNQCVLGYTKAFVVA
HPQHPLCNASLHSIASLANYRQISLGSRSGQHSNLLRPVSDKVLFVENFDDMLRLVEAGVGWGIAPHYFVEERLRNGTLA
VLSELYEPGGIDTKVYCYYNTALESERSFLRFLESARQRLRELG
The query sequence (length=204) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.
# | Hit | Hit length |
Aligned length |
Identity (normalized by query) |
Identity (normalized by hit) |
Identity (normalized by aligned length) |
E-value | Homologs to hit |
---|---|---|---|---|---|---|---|---|
1 | 6yiz:A | 211 | 204 | 1.0000 | 0.9668 | 1.0000 | 6.90e-152 | 6b8a:A, 6b8a:B, 4jvd:A, 4jvi:A, 7nbw:A, 7o2t:AAA, 7o2u:AAA, 7p4u:A, 8q5k:A, 8q5l:A, 6q7u:A, 6q7v:A, 6q7v:B, 6q7w:A, 7qa0:A, 7qa0:B, 7qa3:A, 7qa3:B, 7qav:A, 7qav:B, 6tpr:A, 6yiz:B, 6yz3:AAA, 6z07:AAA, 6z17:AAA, 6z5k:AAA |
2 | 6xtv:B | 290 | 69 | 0.1078 | 0.0759 | 0.3188 | 0.63 | |
3 | 3fd3:A | 207 | 69 | 0.1078 | 0.1063 | 0.3188 | 0.63 | |
4 | 2wle:C | 211 | 106 | 0.1422 | 0.1374 | 0.2736 | 2.3 | 2wle:A, 2wle:B, 2wlf:A, 2wlf:C, 2wlf:B, 2wlg:A, 2wlg:C, 2wlg:B |
5 | 3e49:A | 307 | 49 | 0.0882 | 0.0586 | 0.3673 | 3.8 | 3e49:B, 3e49:C, 3e49:D |
6 | 6gbn:B | 435 | 59 | 0.0784 | 0.0368 | 0.2712 | 4.5 | 6gbn:A, 6gbn:C, 6gbn:D |
7 | 1umg:A | 359 | 114 | 0.1324 | 0.0752 | 0.2368 | 4.7 | 3r1m:A |
8 | 5vsu:A | 387 | 142 | 0.1765 | 0.0930 | 0.2535 | 8.2 | 6aso:A, 2kh9:A, 4n0t:A, 5tf6:A, 5tf6:C |
9 | 6cw3:G | 92 | 52 | 0.0784 | 0.1739 | 0.3077 | 9.2 | |
10 | 6nu2:z | 204 | 75 | 0.0980 | 0.0980 | 0.2667 | 9.6 | 7l08:z, 7l20:z, 7nsh:BG, 7nsi:BG, 6zs9:A5 |