BioLiP

>protein
RMKQLEDKVEELLSKAYHLENEVARLKKLVGE

The query sequence (length=32) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.

#	Hit	Hit length	Aligned length	Identity (normalized by query)	Identity (normalized by hit)	Identity (normalized by aligned length)	E-value	Homologs to hit
1	1ysa:C	57	32	0.9688	0.5439	0.9688	2.13e-15	1dgc:A, 2dgc:A, 1ysa:D
2	3i5c:B	198	30	0.9062	0.1465	0.9667	1.07e-12	3i5c:A, 1ij0:A, 1ij0:B, 1ij0:C, 1ij1:A, 1ij1:B, 1ij1:C, 3k7z:A, 3k7z:B, 1rb4:A, 1rb4:B, 1swi:C, 6xne:C
3	5apw:B	64	29	0.8750	0.4375	0.9655	1.35e-12
4	5apw:B	64	30	0.8438	0.4219	0.9000	2.55e-12
5	1llm:C	87	28	0.8438	0.3103	0.9643	4.58e-12	1llm:D
6	3crp:B	34	32	0.8125	0.7647	0.8125	1.14e-11	2b1f:A, 2b1f:C, 3crp:C
7	1uo4:B	31	31	0.7188	0.7419	0.7419	5.78e-11	1uo5:A
8	2bni:C	34	32	0.6875	0.6471	0.6875	6.24e-11	2bni:D, 1u9h:A
9	1fav:A	78	28	0.6250	0.2564	0.7143	1.72e-10	6j5e:G, 6tvq:AaA, 6tvu:AaA, 6tvw:CCC, 3vgx:C, 3vu5:A, 3vu6:A, 3w19:C, 5yb4:E, 5yb4:F, 5yb4:D
10	1uny:B	30	30	0.6875	0.7333	0.7333	8.71e-10
11	1czq:A	45	30	0.5938	0.4222	0.6333	1.02e-07	1gzl:A, 1gzl:B, 3l35:A, 3l35:C, 3l35:B, 3l36:A, 3l37:A, 3mgn:D, 3mgn:F, 3mgn:A, 3mgn:C, 3mgn:E, 3mgn:B, 6psa:A, 2q3i:A, 2r3c:A, 2r3c:B, 2r5b:A, 2r5b:C, 2r5b:B, 2r5d:A, 2r5d:C, 2r5d:B
12	2r2v:C	33	32	0.5625	0.5455	0.5625	1.02e-06	2r2v:D
13	4hjb:C	30	31	0.5938	0.6333	0.6129	2.95e-06	4hjb:D
14	3w8v:A	32	32	0.6250	0.6250	0.6250	6.87e-05	3w8v:B, 3w92:A, 3w92:B, 3w92:C, 3w93:A, 3w93:B, 3w93:C
15	3hf0:A	30	16	0.3125	0.3333	0.6250	4.5
16	4oo8:A	1301	22	0.3125	0.0077	0.4545	8.5	4zt0:C

[Back]