BioLiP

>protein
RMKQIEDKLEEILSKLYHIEMELFIKMLLG

The query sequence (length=30) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.

#	Hit	Hit length	Aligned length	Identity (normalized by query)	Identity (normalized by hit)	Identity (normalized by aligned length)	E-value	Homologs to hit
1	4hjb:C	30	30	1.0000	1.0000	1.0000	2.33e-14	4hjb:D
2	1uny:B	30	23	0.7333	0.7333	0.9565	1.65e-08
3	1uo4:B	31	30	0.8333	0.8065	0.8333	9.37e-08	1uo5:A
4	2bni:C	34	31	0.8000	0.7059	0.7742	5.87e-07	2bni:D, 1u9h:A
5	1ysa:C	57	31	0.6333	0.3333	0.6129	1.30e-06	1dgc:A, 2dgc:A, 1ysa:D
6	1fav:A	78	27	0.6333	0.2436	0.7037	3.30e-05	6j5e:G, 6tvq:AaA, 6tvu:AaA, 6tvw:CCC, 3vgx:C, 3vu5:A, 3vu6:A, 3w19:C, 5yb4:E, 5yb4:F, 5yb4:D
7	3i5c:B	198	23	0.5333	0.0808	0.6957	5.90e-05	3i5c:A, 1ij0:A, 1ij0:B, 1ij0:C, 1ij1:A, 1ij1:B, 1ij1:C, 3k7z:A, 3k7z:B, 1rb4:A, 1rb4:B, 1swi:C, 6xne:C
8	5apw:B	64	22	0.5000	0.2344	0.6818	7.76e-05
9	5apw:B	64	22	0.5000	0.2344	0.6818	7.76e-05
10	2r2v:C	33	31	0.5667	0.5152	0.5484	1.10e-04	2r2v:D
11	1czq:A	45	30	0.6667	0.4444	0.6667	0.002	1gzl:A, 1gzl:B, 3l35:A, 3l35:C, 3l35:B, 3l36:A, 3l37:A, 3mgn:D, 3mgn:F, 3mgn:A, 3mgn:C, 3mgn:E, 3mgn:B, 6psa:A, 2q3i:A, 2r3c:A, 2r3c:B, 2r5b:A, 2r5b:C, 2r5b:B, 2r5d:A, 2r5d:C, 2r5d:B
12	1llm:C	87	27	0.5000	0.1724	0.5556	0.010	1llm:D
13	3crp:B	34	31	0.4667	0.4118	0.4516	0.014	2b1f:A, 2b1f:C, 3crp:C
14	6irw:A	494	17	0.3000	0.0182	0.5294	2.6	6irw:B
15	6iry:A	468	17	0.3000	0.0192	0.5294	5.1	6irz:A, 6is0:A
16	7xzi:A	1598	19	0.3000	0.0056	0.4737	7.3
17	8x38:A	430	23	0.3333	0.0233	0.4348	8.2
18	1esd:A	302	14	0.2667	0.0265	0.5714	9.2

[Back]