BioLiP

>protein
RLVQLSRHSIAFPSPEGALREPNGLLALGGDLSPARLLMAYQRGIFPWFSPGDPILWWSPDPRAVLWPESLHISRSMKRF
HKRSPYRVTMNYAFGQVIEGCASDRETWITRGVVEAYHRLHELGHAHSIEVWREDELVGGMYGVAQGTLFCGESMFSRME
NASKTALLVFCEEFIGHGGKLIDCQVLNDHTASLGACEIPRRDYLNYLNQMRLGRLPNNFWVPRCLFSP

The query sequence (length=229) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.

#	Hit	Hit length	Aligned length	Identity (normalized by query)	Identity (normalized by hit)	Identity (normalized by aligned length)	E-value	Homologs to hit
1	2dpt:A	232	231	1.0000	0.9871	0.9913	2.22e-171	2dpt:B, 2z3k:A, 2z3k:B, 2z3l:B, 2z3l:A, 2z3m:A, 2z3m:B, 2z3n:A, 2z3n:B, 2z3o:A, 2z3o:B, 2z3p:A, 2z3p:B
2	6yw5:BB	290	45	0.0655	0.0517	0.3333	2.1	6ywe:BB, 6ywx:BB, 6ywy:BB
3	3m7p:A	301	43	0.0611	0.0465	0.3256	2.4
4	7qvw:AAA	597	24	0.0437	0.0168	0.4167	3.3	1qhb:A, 1qhb:B, 1qhb:C, 1qhb:D, 1qhb:E, 1qhb:F, 7qvw:BBB, 7qvw:CCC, 7qvw:DDD, 7qw3:AAA, 7qw3:BBB, 7qw3:CCC, 7qw3:DDD, 7qwi:AAA, 7qwi:BBB, 7qwi:CCC, 7qwi:DDD, 7qyy:AAA, 7qyy:BBB, 7qyy:CCC, 7qyy:DDD, 1up8:A, 1up8:B, 1up8:C, 1up8:D
5	6ofs:A	905	34	0.0568	0.0144	0.3824	3.5
6	8t4e:B	551	65	0.0786	0.0327	0.2769	3.7	8t4f:B, 8t4g:B, 8t4h:B, 8t4i:B, 8t4j:B
7	1j70:A	512	74	0.0917	0.0410	0.2838	5.1	1g8f:A, 1g8g:A, 1g8g:B, 1g8h:A, 1g8h:B, 1j70:B, 1j70:C, 1jec:A, 1jed:A, 1jed:B, 1jee:A, 1jee:B, 1r6x:A
8	2e40:A	459	58	0.0786	0.0392	0.3103	9.5	2e40:B

[Back]