BioLiP

>protein
RLSDDALAFLSERHLAMLTTLRADNSPHVVAVGFTFDPKTHIARVITTGGSQKAVNADRSGLAVLSQVDGARWLSLEGRA
AVNSDIDAVRDAELRYAQRYRTPRPNPRRVVIEVQIERVLGSADLLD

The query sequence (length=127) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.

#	Hit	Hit length	Aligned length	Identity (normalized by query)	Identity (normalized by hit)	Identity (normalized by aligned length)	E-value	Homologs to hit
1	5jab:A	135	127	1.0000	0.9407	1.0000	1.34e-89	2asf:A, 5jab:B, 5jab:C, 5jab:D
2	8aa2:E	497	66	0.1654	0.0423	0.3182	0.005	8aa2:M, 6r3r:A, 6r3u:A, 7znr:A, 7znr:B, 7zns:A, 7zns:B
3	4tm7:A	243	42	0.1260	0.0658	0.3810	0.52
4	8hku:L13P	140	72	0.1969	0.1786	0.3472	1.00	8hkv:L13P, 8hky:L13P, 8hkz:L13P, 8hl1:L13P, 8hl2:L13P, 8hl3:L13P, 8hl4:L13P, 8hl5:L13P
5	5jv4:A	142	30	0.1024	0.0915	0.4333	1.4	5jv4:D, 5jv4:B, 5jv4:E, 5jv4:C, 5jv4:F
6	1e8u:B	449	50	0.1181	0.0334	0.3000	4.5	7bwu:B, 7bwu:D, 7bwu:A, 7bwu:C, 1e8t:A, 1e8u:A, 1e8v:A, 1e8v:B, 1usr:A, 1usr:B, 1usx:A, 1usx:B, 1usx:C
7	6hyp:A	2272	46	0.1102	0.0062	0.3043	5.8
8	5jcs:s	2003	46	0.1102	0.0070	0.3043	6.6
9	1ddv:A	104	32	0.0787	0.0962	0.3125	6.7
10	7suk:LV	362	88	0.1732	0.0608	0.2500	7.7	7ajt:JC, 7d63:RA, 6ke6:RA, 6lqp:RA, 6lqq:RA, 6lqr:RA, 6lqu:RA, 6lqv:RA, 5wlc:LV, 6zqb:JC, 6zqc:JC
11	7wi7:A	565	34	0.0945	0.0212	0.3529	8.1
12	8omd:A	296	47	0.0945	0.0405	0.2553	9.1	8omd:C, 8omd:B, 8omd:D, 6p2d:A

[Back]