RLQLDAHASIHENVRRLLQFTTSIMEANEEGIRKDIDSEFLHDFRVAIRRSRSILRLLNGVFDPEKTAWMLAGLRELGKR
TNDLRDSDVYLLRREEYTSLLPPSLRPALDPFFSDLEADKRLHHRQFCRYLTGREYSGFMTSLKEFIAEGELPDPETAPL
AAEPTGDVAAKTIRKALKKVLVHGRRTGSETSDAELHELRIDCKKLRYLLEFFASLFPPKATAQVLRQMKTLQDNLGTFV
DLTVQMEFLQSRLETIPADRGGISEAAAIGGLLTTLYRKREKVREHFHEIFSGFDSNETGELFDELLTGL
The query sequence (length=310) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.
# | Hit | Hit length |
Aligned length |
Identity (normalized by query) |
Identity (normalized by hit) |
Identity (normalized by aligned length) |
E-value | Homologs to hit |
---|---|---|---|---|---|---|---|---|
1 | 6qva:A | 310 | 310 | 1.0000 | 1.0000 | 1.0000 | 0.0 | |
2 | 6qv5:A | 289 | 223 | 0.2065 | 0.2215 | 0.2870 | 1.61e-10 | |
3 | 5et1:A | 331 | 100 | 0.0935 | 0.0876 | 0.2900 | 1.2 | 5et0:A, 5et0:C, 5et1:B |
4 | 4iv9:A | 552 | 72 | 0.0710 | 0.0399 | 0.3056 | 1.6 | 4iv9:B |
5 | 8uau:A | 332 | 106 | 0.0839 | 0.0783 | 0.2453 | 2.2 | |
6 | 8bf8:A | 302 | 97 | 0.0774 | 0.0795 | 0.2474 | 4.2 | |
7 | 7aih:Aa | 178 | 52 | 0.0484 | 0.0843 | 0.2885 | 5.8 | 7am2:Aa, 7ane:Aa |
8 | 8h1j:A | 362 | 123 | 0.0935 | 0.0801 | 0.2358 | 6.6 | 8ex9:A, 8exa:A |
9 | 7vua:A | 785 | 82 | 0.0742 | 0.0293 | 0.2805 | 8.6 | 7vua:B |