RLCQVDRCTVNLTEAKQYYRRHRVCEVHAKASAATVAGVRQRFCQQCSRFHELPEFDEAKRSCRRR
The query sequence (length=66) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.
# | Hit | Hit length |
Aligned length |
Identity (normalized by query) |
Identity (normalized by hit) |
Identity (normalized by aligned length) |
E-value | Homologs to hit |
---|---|---|---|---|---|---|---|---|
1 | 8pfc:L | 70 | 66 | 1.0000 | 0.9429 | 1.0000 | 3.05e-43 | 8j49:A, 8pfc:B, 8pfc:D, 8pfc:F, 8pfc:H, 8pfc:J, 8pfc:N, 8pfc:P |
2 | 1ul4:A | 81 | 66 | 0.7576 | 0.6173 | 0.7576 | 4.79e-33 | |
3 | 1wj0:A | 58 | 55 | 0.5303 | 0.6034 | 0.6364 | 1.81e-23 | |
4 | 8j4b:D | 65 | 63 | 0.5303 | 0.5385 | 0.5556 | 2.07e-23 | 8j4b:B |
5 | 1ul5:A | 86 | 64 | 0.5152 | 0.3953 | 0.5312 | 7.74e-20 | |
6 | 3qbe:A | 352 | 42 | 0.1970 | 0.0369 | 0.3095 | 4.8 | 3qbd:A, 3qbd:B |
7 | 7ly7:B | 329 | 52 | 0.2121 | 0.0426 | 0.2692 | 4.8 | 7ly4:A, 7ly4:D, 7ly5:B, 7ly6:A |
8 | 4e6x:C | 305 | 25 | 0.1515 | 0.0328 | 0.4000 | 6.7 | 4e6x:B |
9 | 7mdf:A | 453 | 25 | 0.1515 | 0.0221 | 0.4000 | 6.9 | 4e6w:A, 4e6w:B, 4e6w:C, 7mdc:A |
10 | 4b21:A | 207 | 25 | 0.1515 | 0.0483 | 0.4000 | 8.8 | 4b22:A, 4b23:A, 4b24:A, 4hsb:A |
11 | 5n6u:A | 811 | 29 | 0.1667 | 0.0136 | 0.3793 | 9.4 | 5n6u:B, 5n6u:C, 5n6u:D |
12 | 2ct2:A | 88 | 45 | 0.1818 | 0.1364 | 0.2667 | 9.8 | 5fey:A, 5fey:B |
13 | 3geh:A | 442 | 52 | 0.2273 | 0.0339 | 0.2885 | 9.9 |