RKYPFLRRPHIKNTHSMNPSAPYFWSFMTAKSQMAFLPEENYITGDWTGKFFVSKRQVYTLQHATSGAKVRVKSFPSIFE
FNSPSRWNIGKEMNTLTKP
The query sequence (length=99) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.
| # | Hit | Hit length |
Aligned length |
Identity (normalized by query) |
Identity (normalized by hit) |
Identity (normalized by aligned length) |
E-value | Homologs to hit |
|---|---|---|---|---|---|---|---|---|
| 1 | 7pub:CS | 139 | 99 | 1.0000 | 0.7122 | 1.0000 | 9.31e-72 | 7pua:CS, 6sg9:CS, 6sgb:CS |
| 2 | 7aor:n | 142 | 99 | 0.8788 | 0.6127 | 0.8788 | 3.86e-63 | 6hiv:CS, 6hiw:CS, 6hiz:CS |
| 3 | 7ane:n | 142 | 99 | 0.8687 | 0.6056 | 0.8687 | 2.41e-62 | |
| 4 | 1lwu:B | 315 | 45 | 0.1212 | 0.0381 | 0.2667 | 0.16 | 1lwu:E, 1lwu:H, 1lwu:K, 1n73:B, 1n73:E |
| 5 | 8rd8:Af | 211 | 53 | 0.1818 | 0.0853 | 0.3396 | 1.5 | 8rdv:Af, 8rdw:Af |
umich.edu