RKWSGKVHALLPNTKPEQAWTLLKDFINLHKVMPSLSVCELVEGEANVVGCVRYVKGIMHPIEEEFWAKEKLVALDNKNM
SYSYIFTECFTGYEDYTATMQIVEGPEHKGSRFDWSFQCKYIEGMTESAFTEILQHWATEIGQKIEEVCSA
The query sequence (length=151) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.
# | Hit | Hit length |
Aligned length |
Identity (normalized by query) |
Identity (normalized by hit) |
Identity (normalized by aligned length) |
E-value | Homologs to hit |
---|---|---|---|---|---|---|---|---|
1 | 5vgs:A | 153 | 147 | 0.9669 | 0.9542 | 0.9932 | 6.38e-109 | 5gte:A, 5gte:B, 5gtg:A, 6ies:A, 6ies:B |
2 | 5e4m:A | 177 | 134 | 0.2119 | 0.1808 | 0.2388 | 0.006 | 5e4b:A, 5e4b:B, 5e4m:B |
3 | 5vil:A | 271 | 41 | 0.1192 | 0.0664 | 0.4390 | 1.0 | 4bf2:A, 4bf2:B, 4bhn:A, 4bhn:B, 4bib:A, 4bib:B, 4bic:A, 4bic:B, 4bid:A, 4bid:B, 4bie:A, 4bie:B, 2clq:A, 2clq:B, 6e2m:A, 6e2n:A, 6e2o:A, 6e2o:B, 7mu6:A, 7mu6:B, 7mu7:A, 7mu7:B, 6oyw:A, 6oyw:B, 6oyw:C, 6oyw:D, 5uor:B, 5uox:A, 5uox:B, 5up3:A, 5v19:A, 5v19:B, 5v24:B, 5vil:B, 5vil:C, 5vil:D, 5vio:A, 5vio:B, 5vio:D, 6vre:A, 6vre:B, 3vw6:A, 3vw6:B, 6xih:A |
4 | 8h3j:A | 162 | 108 | 0.1921 | 0.1790 | 0.2685 | 1.2 | |
5 | 3fp0:A | 511 | 42 | 0.0728 | 0.0215 | 0.2619 | 7.1 |