BioLiP

>protein
RKTRHDPPAKSKVGRVQTPPAVDPAEFFVLTERYRQYRETVRALRLEFTLEVRRKLHEARAGVLAERKAQQAITEHRELM
AWNRDENRRMQELRIARLQLEAQAQEVQKAEAQAQRAQEEQAWVQLKEQEVLKLQEEAKNFITRENLEARIEEALDSPKS
YNWAVTKEGQVVRN

The query sequence (length=174) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.

#	Hit	Hit length	Aligned length	Identity (normalized by query)	Identity (normalized by hit)	Identity (normalized by aligned length)	E-value	Homologs to hit
1	7pnt:U	174	174	1.0000	1.0000	1.0000	3.34e-123	7pnu:U, 7pnv:U, 7pnw:U
2	5aj3:d	177	173	0.7701	0.7571	0.7746	2.99e-91	5aj4:Ad, 6gaw:Ad, 6gaz:Ad, 7nqh:Ad, 7nql:Ad, 7nsi:Ad, 7nsj:Ad, 8oin:AU, 8oip:AU, 6ydp:Ad, 6ydw:Ad
3	3jd5:d	176	172	0.7759	0.7670	0.7849	3.35e-86	6neq:d, 6nf8:d
4	7l08:AU	177	173	0.7126	0.7006	0.7168	3.76e-79	7a5f:U6, 7a5g:U6, 7a5i:U6, 7a5k:U6, 8any:AU, 8csp:U, 8csq:U, 8csr:U, 8css:U, 8cst:U, 8csu:U, 3j9m:AU, 8k2a:Sb, 6nu2:AU, 6nu3:AU, 7og4:AU, 8oir:AU, 8ois:AU, 7p2e:U, 7pnx:U, 7pny:U, 7pnz:U, 7po0:U, 7po1:U, 7po2:U, 7po3:U, 7qi4:AU, 7qi5:AU, 7qi6:AU, 8qrk:U, 8qrl:U, 8qrm:U, 8qrn:U, 6rw4:U, 6rw5:U, 6vlz:AU, 6vmi:AU, 8xt0:Sb, 8xt2:Sb, 6zm5:AU, 6zm6:AU, 6zs9:AU, 6zsa:AU, 6zsb:AU, 6zsc:AU, 6zsd:AU, 6zse:AU, 6zsg:AU
5	7pkq:w	155	34	0.0747	0.0839	0.3824	0.12
6	6zu5:LE0	179	61	0.0920	0.0894	0.2623	0.28
7	4nj5:A	482	54	0.1149	0.0415	0.3704	0.89
8	8bgw:A	750	44	0.1092	0.0253	0.4318	2.2	8bgw:B, 6qq5:A, 6qq5:B, 6qq6:A, 6qq6:B, 6t6v:A

[Back]