RKTRHDPPAKSKAGRVATPPAVDPTEFFVLTERYRQYRQTVRALRLEFMSEVRKKLHEARAGVQAERKAQEDAAEHRELM
AWNQAENQRLHELRLARLRQEALEQERRQAEEAVLQAREAQAWAQLKEQEVLQLQEEAKTFITRENLEARVEEALDSPKS
YNWAITREGLVVRPQQK
The query sequence (length=177) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.
# | Hit | Hit length |
Aligned length |
Identity (normalized by query) |
Identity (normalized by hit) |
Identity (normalized by aligned length) |
E-value | Homologs to hit |
---|---|---|---|---|---|---|---|---|
1 | 5aj3:d | 177 | 177 | 1.0000 | 1.0000 | 1.0000 | 1.07e-124 | 5aj4:Ad, 6gaw:Ad, 6gaz:Ad, 7nqh:Ad, 7nql:Ad, 7nsi:Ad, 7nsj:Ad, 8oin:AU, 8oip:AU, 6ydp:Ad, 6ydw:Ad |
2 | 3jd5:d | 176 | 175 | 0.8531 | 0.8580 | 0.8629 | 6.60e-95 | 6neq:d, 6nf8:d |
3 | 7pnt:U | 174 | 173 | 0.7571 | 0.7701 | 0.7746 | 3.05e-91 | 7pnu:U, 7pnv:U, 7pnw:U |
4 | 7l08:AU | 177 | 177 | 0.7853 | 0.7853 | 0.7853 | 1.47e-85 | 7a5f:U6, 7a5g:U6, 7a5i:U6, 7a5k:U6, 8any:AU, 8csp:U, 8csq:U, 8csr:U, 8css:U, 8cst:U, 8csu:U, 3j9m:AU, 8k2a:Sb, 6nu2:AU, 6nu3:AU, 7og4:AU, 8oir:AU, 8ois:AU, 7p2e:U, 7pnx:U, 7pny:U, 7pnz:U, 7po0:U, 7po1:U, 7po2:U, 7po3:U, 7qi4:AU, 7qi5:AU, 7qi6:AU, 8qrk:U, 8qrl:U, 8qrm:U, 8qrn:U, 6rw4:U, 6rw5:U, 6vlz:AU, 6vmi:AU, 8xt0:Sb, 8xt2:Sb, 6zm5:AU, 6zm6:AU, 6zs9:AU, 6zsa:AU, 6zsb:AU, 6zsc:AU, 6zsd:AU, 6zse:AU, 6zsg:AU |
5 | 8asd:A | 1826 | 97 | 0.1299 | 0.0126 | 0.2371 | 0.41 | |
6 | 8asb:A | 1715 | 97 | 0.1299 | 0.0134 | 0.2371 | 0.41 | 8as6:A, 8asg:A, 8r6u:A |
7 | 8r6y:A | 1991 | 97 | 0.1299 | 0.0116 | 0.2371 | 0.43 | 8as7:A, 8r6w:A, 6xya:B |
8 | 7alp:U | 1935 | 97 | 0.1299 | 0.0119 | 0.2371 | 0.49 | |
9 | 7udu:D | 701 | 140 | 0.2034 | 0.0514 | 0.2571 | 0.88 | 7rb8:D |
10 | 7pkq:w | 155 | 33 | 0.0621 | 0.0710 | 0.3333 | 2.5 | |
11 | 6zu5:LE0 | 179 | 52 | 0.0847 | 0.0838 | 0.2885 | 3.4 | |
12 | 7yfr:A | 691 | 43 | 0.0960 | 0.0246 | 0.3953 | 4.9 | 7yfr:C |
13 | 3dh9:A | 482 | 76 | 0.1243 | 0.0456 | 0.2895 | 5.5 | 3dgh:A, 3dgh:B, 3dh9:B, 2nvk:X |
14 | 5ty0:A | 378 | 28 | 0.0621 | 0.0291 | 0.3929 | 8.6 | |
15 | 8anp:D | 391 | 63 | 0.0734 | 0.0332 | 0.2063 | 9.2 | |
16 | 7ayx:B | 396 | 39 | 0.0678 | 0.0303 | 0.3077 | 9.6 | 7ayx:A |