RKRNRIPLGCTICRKRKVKCDKLRPHCQQCTKTGVAHLCHYMEQTWAEEAEKELLKDNELKKLRERVKSLEKTLS
The query sequence (length=75) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.
# | Hit | Hit length |
Aligned length |
Identity (normalized by query) |
Identity (normalized by hit) |
Identity (normalized by aligned length) |
E-value | Homologs to hit |
---|---|---|---|---|---|---|---|---|
1 | 2hap:C | 76 | 75 | 0.9867 | 0.9737 | 0.9867 | 1.09e-48 | 2hap:D, 1hwt:C, 1hwt:D, 1hwt:G, 1hwt:H, 1pyc:A, 1qp9:A, 1qp9:B, 1qp9:C, 1qp9:D |
2 | 6gys:B | 579 | 48 | 0.2400 | 0.0311 | 0.3750 | 4.87e-05 | 6f07:B, 6gyp:B, 6gys:C, 6gys:J, 6gys:I, 6gyu:B, 7k7g:M, 8ow1:CE |
3 | 3coq:A | 89 | 37 | 0.2000 | 0.1685 | 0.4054 | 0.039 | 3coq:B, 1d66:A, 1d66:B, 7uik:T, 7uik:U, 7uio:GA, 7uio:GB |
4 | 1aw6:A | 43 | 31 | 0.1733 | 0.3023 | 0.4194 | 0.065 | |
5 | 1ajy:A | 71 | 40 | 0.1867 | 0.1972 | 0.3500 | 0.096 | 1ajy:B, 1zme:C, 1zme:D |
6 | 1pyi:A | 88 | 28 | 0.1600 | 0.1364 | 0.4286 | 0.39 | 1pyi:B |
7 | 1cld:A | 33 | 27 | 0.1600 | 0.3636 | 0.4444 | 0.83 | |
8 | 2yfn:A | 719 | 31 | 0.1467 | 0.0153 | 0.3548 | 2.3 | 2yfo:A |
9 | 7qbu:A | 418 | 60 | 0.2533 | 0.0455 | 0.3167 | 4.2 | 7qbs:A, 7qbt:A, 7qbt:B, 7qbt:C, 7qbt:D, 7qbu:B, 7qbv:A, 7qbv:B, 7qbv:C, 7qbv:D |
10 | 8i9r:Cg | 233 | 35 | 0.1467 | 0.0472 | 0.3143 | 5.9 | 8i9t:Cg |
11 | 4ail:C | 750 | 31 | 0.1467 | 0.0147 | 0.3548 | 6.7 | 2jgu:A |