BioLiP

>protein
RKRLGDLLVEEGIVSEAQLEQALNAQKNTGRRLGDTLISLGFLSETQLLNFLAQQLSLPVIDLSRAHVDIDAVPLLPEVH
ARRLRALVIGRSGDTLRIAMSDPADLFAQEALLNQLPDYGFEFVIAPEKQLVDGFDRYY

The query sequence (length=139) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.

#	Hit	Hit length	Aligned length	Identity (normalized by query)	Identity (normalized by hit)	Identity (normalized by aligned length)	E-value	Homologs to hit
1	5htl:A	141	139	1.0000	0.9858	1.0000	2.06e-97	5htl:B
2	8pkz:A	146	114	0.2950	0.2808	0.3596	2.64e-08	8pdk:A, 8pdk:B, 8pe0:A, 8pe0:B, 8pfa:A, 8pfa:B
3	3akk:A	296	70	0.1367	0.0642	0.2714	0.037	3akk:B, 3akk:C, 3akk:D, 3akl:A, 3akl:B, 3akl:C, 3akl:D
4	3nxl:C	425	75	0.1727	0.0565	0.3200	0.15	3nxl:A, 3nxl:B, 3nxl:D
5	8rd8:BQ	131	78	0.1727	0.1832	0.3077	0.57	8rdv:BQ, 8rdw:BQ
6	7zs0:A	278	53	0.1367	0.0683	0.3585	0.72	7zs1:A, 7zs2:A
7	4q2t:A	590	84	0.1727	0.0407	0.2857	3.6	4q2t:B, 4q2x:A, 4q2x:B
8	7moq:C	4159	47	0.1295	0.0043	0.3830	4.1	6zyy:C
9	8bwy:C	4264	47	0.1295	0.0042	0.3830	4.2
10	6zyw:C	4433	47	0.1295	0.0041	0.3830	4.2
11	8bx8:A	4453	47	0.1295	0.0040	0.3830	4.2	7k58:A, 7k5b:A, 7kek:A
12	1rzu:B	478	49	0.1079	0.0314	0.3061	4.4	1rzu:A
13	6in2:A	124	19	0.0719	0.0806	0.5263	5.3	5fg6:A, 5n49:B, 3rcw:C
14	5pny:B	124	19	0.0719	0.0806	0.5263	5.5	5amf:A, 5pnx:A, 5pnz:B, 5po0:A, 5po1:B, 5po2:A, 5po3:B, 5po4:B, 5po6:A, 5po7:A, 5po7:B, 5po8:A, 5po8:B, 5po9:A, 5po9:B, 5poa:B, 5pob:A, 5pob:B, 5poc:A, 5pod:A, 5pod:B, 5poe:A, 5poe:B, 5pof:A, 5pof:B, 5pog:A, 5pog:B, 5poh:A, 5poh:B, 5poi:A, 5poi:B, 5poj:A, 5poj:B, 5pok:A, 5pok:B, 5pol:A, 5pol:B, 5pom:A, 5pom:B, 5pon:A, 5pon:B, 5poo:A, 5poo:B, 5pop:A, 5pop:B, 5poq:A, 5poq:B, 5pos:A, 5pos:B, 5pot:A, 5pou:B, 5pov:A, 5pov:B, 5pow:A, 5pow:B, 5pox:A, 5poy:A, 5poy:B, 5poz:A, 5pp0:B

[Back]