RKPRIRDRLPKARFIAKSGACNLAHKNIREQGRFLQDIFTTLVDLKWRHTLVIFTMSFLCSWLLFAIMWWLVAFAHGDIY
The query sequence (length=346) is searched through a non-redundant set of database sequences
clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.
# |
Hit |
Hit length |
Aligned length |
Identity (normalized by query) |
Identity (normalized by hit) |
Identity (normalized by aligned length) |
E-value |
Homologs to hit |
1 |
7mjp:A |
366 |
344 |
0.9942 |
0.9399 |
1.0000 |
0.0 |
7mit:A, 7mit:B, 7mit:C, 7mit:D, 7mjo:A, 7mjo:B, 7mjo:C, 7mjo:D, 7mjp:B, 7mjp:D, 7mjq:A, 7mjq:B, 7mjq:C |
2 |
7tys:A |
361 |
331 |
0.6994 |
0.6704 |
0.7311 |
0.0 |
6baa:A, 6baa:D, 6baa:B, 6baa:C, 6c3o:A, 6c3o:B, 6c3o:C, 6c3o:D, 6c3p:A, 6c3p:B, 6c3p:D, 6c3p:C, 6jb1:A, 6jb1:G, 6jb1:C, 6jb1:E, 8ti1:D, 8ti1:A, 8ti1:B, 8ti1:C, 8ti2:D, 8ti2:A, 8ti2:B, 8ti2:C, 5twv:A, 5twv:C, 5twv:E, 5twv:G, 7tys:D, 7tys:B, 7tys:C, 7tyt:A, 7tyt:D, 7tyt:B, 7tyt:C, 7u1e:B, 7u1e:C, 7u1e:D, 7u1e:A, 7u1q:A, 7u1q:B, 7u1q:C, 7u1q:D, 7u1s:A, 7u1s:D, 7u1s:B, 7u1s:C, 7u24:A, 7u24:D, 7u24:B, 7u24:C, 7u6y:A, 7u6y:B, 7u6y:C, 7u6y:D, 7uaa:B, 7uaa:C, 7uaa:D, 7w4p:A, 7w4p:C, 7w4p:E, 7w4p:G, 5ykf:A, 5ykf:C, 5ykf:E, 5ykf:G, 5ykg:A, 5ykg:C, 5ykg:E, 5ykg:G, 5yw8:C, 5yw8:E, 5yw8:G, 5yw8:A, 5yw9:C, 5yw9:E, 5yw9:G, 5yw9:A, 5ywa:A, 5ywa:C, 5ywa:E, 5ywa:G, 5ywb:A, 5ywb:C, 5ywb:E, 5ywb:G, 5ywc:A, 5ywc:C, 5ywc:E, 5ywc:G |
3 |
4kfm:A |
328 |
326 |
0.4711 |
0.4970 |
0.5000 |
9.15e-123 |
3auw:B, 3auw:D, 3sya:A, 3syo:A, 6xeu:A, 6xeu:D, 6xeu:G, 6xeu:J, 6xev:A, 6xev:E, 6xev:I, 6xev:M, 6xit:A, 6xit:B, 6xit:C, 6xit:D |
4 |
3spg:A |
332 |
337 |
0.4711 |
0.4910 |
0.4837 |
7.91e-113 |
5kuk:A, 5kum:A, 6m84:A, 3spc:A, 3sph:A, 3spi:A |
5 |
3syq:A |
292 |
326 |
0.4393 |
0.5205 |
0.4663 |
4.31e-107 |
|
6 |
8i5m:A |
310 |
319 |
0.3699 |
0.4129 |
0.4013 |
7.27e-79 |
8i5m:B, 8i5m:C, 8i5m:D, 8i5n:A, 8i5n:B, 8i5n:C, 8i5n:D |
7 |
2wll:B |
266 |
220 |
0.1792 |
0.2331 |
0.2818 |
1.14e-26 |
|
8 |
2x6b:A |
287 |
311 |
0.2457 |
0.2962 |
0.2733 |
1.75e-22 |
7n9k:A, 7n9l:A, 6o9t:A, 6o9u:A, 6o9v:A, 6o9v:B, 2x6a:A, 2x6c:A |
9 |
1yt3:A |
375 |
90 |
0.0751 |
0.0693 |
0.2889 |
0.67 |
|
10 |
1zb7:A |
414 |
79 |
0.0665 |
0.0556 |
0.2911 |
1.0 |
|
11 |
8u0i:A |
85 |
22 |
0.0318 |
0.1294 |
0.5000 |
5.8 |
|
12 |
7kri:A |
127 |
25 |
0.0318 |
0.0866 |
0.4400 |
6.8 |
7kri:B, 7kri:C, 7n3k:A, 7n3k:B, 7n3k:C, 7n3k:D, 7n3k:E, 7n3k:F, 7n3k:G, 7n3k:H |
13 |
5ogx:A |
333 |
69 |
0.0520 |
0.0541 |
0.2609 |
7.0 |
|