RKIPLRKSVVSNEVIDKRDLLRIVKNKEGQVFIDPTGKANGRGAYIKLDNAEALEAKKKKVFNRSFSMEVEESFYDELIA
YVDHKVKRRELGLE
The query sequence (length=94) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.
# | Hit | Hit length |
Aligned length |
Identity (normalized by query) |
Identity (normalized by hit) |
Identity (normalized by aligned length) |
E-value | Homologs to hit |
---|---|---|---|---|---|---|---|---|
1 | 1g2r:A | 94 | 94 | 1.0000 | 1.0000 | 1.0000 | 9.63e-64 | |
2 | 8adb:A | 209 | 54 | 0.2021 | 0.0909 | 0.3519 | 0.13 | |
3 | 7vyx:A | 1211 | 64 | 0.1915 | 0.0149 | 0.2812 | 0.93 | 7vyx:B |
4 | 4ojl:C | 759 | 26 | 0.1383 | 0.0171 | 0.5000 | 1.7 | 4ojl:A, 4ojl:B, 4ojo:A, 4ojo:B, 4ojp:A, 4ojp:B, 4ojp:C |
5 | 6yxx:E2 | 369 | 33 | 0.1170 | 0.0298 | 0.3333 | 2.3 | |
6 | 6s1s:A | 367 | 19 | 0.1064 | 0.0272 | 0.5263 | 2.6 | 4hef:A, 6i30:A, 4nk3:A, 4ooy:A, 3s1y:A, 3s22:A, 8sdr:A, 8sds:A, 8sdt:A, 8sdv:A, 6uqs:A, 6uqt:A, 6uqu:A, 6ur3:A, 4wyy:A, 2wzx:A, 2wzz:A, 4wz4:A, 4x68:A, 4x68:B |
7 | 5xxu:H | 177 | 55 | 0.1809 | 0.0960 | 0.3091 | 2.9 | |
8 | 8dk3:A | 455 | 36 | 0.1383 | 0.0286 | 0.3611 | 4.2 | 8dk3:B |
9 | 3pfq:A | 523 | 67 | 0.1915 | 0.0344 | 0.2687 | 4.5 | 1a25:A, 1a25:B, 2i0e:A, 2i0e:B |
10 | 2ph5:A | 459 | 79 | 0.2021 | 0.0414 | 0.2405 | 5.7 | |
11 | 5zbk:A | 182 | 17 | 0.0851 | 0.0440 | 0.4706 | 8.0 | |
12 | 6kby:A | 362 | 42 | 0.1596 | 0.0414 | 0.3571 | 8.6 | 6k9t:A, 6ka5:A, 6m5p:A, 6m5q:A |
13 | 5jrk:A | 695 | 40 | 0.1277 | 0.0173 | 0.3000 | 9.3 | 5jrk:B |