RKFACVECRQQKSKCDAHERAPEPCTKCAKKNVPCILKRDFRRTYKRARNEAIEKRFKELTRTLTNL
The query sequence (length=67) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.
# | Hit | Hit length |
Aligned length |
Identity (normalized by query) |
Identity (normalized by hit) |
Identity (normalized by aligned length) |
E-value | Homologs to hit |
---|---|---|---|---|---|---|---|---|
1 | 2er8:A | 68 | 67 | 1.0000 | 0.9853 | 1.0000 | 1.98e-43 | 2er8:B, 2er8:C, 2er8:D, 2ere:A, 2ere:B, 2erg:A, 2erg:B |
2 | 1pyi:A | 88 | 62 | 0.3134 | 0.2386 | 0.3387 | 0.12 | 1pyi:B |
3 | 7b0n:G | 694 | 36 | 0.1940 | 0.0187 | 0.3611 | 0.31 | 6gcs:A, 7o6y:A, 7o71:A, 6rfq:A, 6rfr:A, 6rfs:A, 6y79:A, 6yj4:G |
4 | 7vqo:A | 1180 | 49 | 0.2090 | 0.0119 | 0.2857 | 0.38 | 7vqo:B, 7vqo:C, 7vqo:D |
5 | 7yoj:A | 867 | 47 | 0.1940 | 0.0150 | 0.2766 | 1.7 | |
6 | 6h8k:A | 628 | 40 | 0.1940 | 0.0207 | 0.3250 | 1.9 | |
7 | 1ajy:A | 71 | 33 | 0.1791 | 0.1690 | 0.3636 | 5.0 | 1ajy:B, 1zme:C, 1zme:D |
8 | 4i7w:A | 294 | 21 | 0.1493 | 0.0340 | 0.4762 | 5.6 | 4i7w:B |
9 | 1cld:A | 33 | 33 | 0.1940 | 0.3939 | 0.3939 | 5.9 | |
10 | 5zln:B | 753 | 19 | 0.1045 | 0.0093 | 0.3684 | 7.7 | 3wpg:A, 3wph:A, 3wpi:A, 5zln:A |