RILLKILLTILIIIALFIGIMYFLSTRDNVDELRKIENKSSFVSADNMPEYVKGAFISMEDERFYNHHGFDLKGTTRALF
STQGGSTITQQVVKNYFYDNDRSFTRKVKELFVAHRVEKQYNKNEILSFYLNNIYFGDNQYTLEGAANHYFGTTVNKNST
TMSHITVLQSAILASKVNAPSVYNINNMSENFTQRVSTNLEKMKQQNYINETQYQQAMSQLNR
The query sequence (length=223) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.
# | Hit | Hit length |
Aligned length |
Identity (normalized by query) |
Identity (normalized by hit) |
Identity (normalized by aligned length) |
E-value | Homologs to hit |
---|---|---|---|---|---|---|---|---|
1 | 3vmr:A | 227 | 227 | 0.9955 | 0.9780 | 0.9780 | 5.65e-163 | 6ftb:A, 3hzs:A, 3vmq:A, 3vmt:A |
2 | 3d3h:A | 174 | 183 | 0.3094 | 0.3966 | 0.3770 | 6.31e-34 | |
3 | 2olv:B | 618 | 175 | 0.2601 | 0.0939 | 0.3314 | 1.31e-22 | 2olv:A |
4 | 5hlb:A | 733 | 154 | 0.2287 | 0.0696 | 0.3312 | 3.14e-20 | |
5 | 3vma:A | 708 | 147 | 0.2018 | 0.0636 | 0.3061 | 8.43e-16 | 5fgz:A, 3fwl:A, 5hl9:A, 5hla:A, 6yn0:A |
6 | 3ue1:A | 604 | 99 | 0.1435 | 0.0530 | 0.3232 | 2.21e-10 | 3udi:A, 3udi:B, 3udx:A, 3udx:B, 3ue0:A, 3ue0:B, 3ue1:B |
7 | 3zg8:B | 458 | 93 | 0.1166 | 0.0568 | 0.2796 | 2.98e-06 | 3zg9:B, 3zga:B |
8 | 5hld:A | 649 | 100 | 0.1435 | 0.0493 | 0.3200 | 1.63e-04 | |
9 | 7ml3:7 | 548 | 68 | 0.0897 | 0.0365 | 0.2941 | 4.7 | |
10 | 1npd:B | 288 | 61 | 0.0762 | 0.0590 | 0.2787 | 4.8 | 1npd:A, 1o9b:A, 1o9b:B, 3t4e:A, 3t4e:B, 1vi2:A, 1vi2:B |